12-Letter Words Starting P & Ending GS
There are 23 12 letter words,
1 12 letter phrase and
0 12 letter abbr's starting with
'P' and ending with
'GS'.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| pawnbrokings | 12 | 24 | ||||||
Valid word for Scrabble US
| ||||||||
| peacemakings | 12 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| papermakings | 12 | 23 | ||||||
noun • the craft of making paper | ||||||||
| pathfindings | 12 | 22 | ||||||
Valid word for Scrabble US
| ||||||||
| playwritings | 12 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| printmakings | 12 | 21 | nounn | |||||
noun • artistic design and manufacture of prints as woodcuts or silkscreens | ||||||||
| platemakings | 12 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| programmings | 12 | 20 | ||||||
noun • setting an order and time for planned events • creating a sequence of instructions to enable the computer to do something | ||||||||
| painstakings | 12 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
| parasailings | 12 | 15 | nounn | |||||
noun • gliding in a parasail | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 12 Letter Words
Words (23)
parasailingspainstakingsplaywritingspeacemakingsprintmakingsprogrammingsplatemakingspathfindingspapermakingspawnbrokingsparallelingsposteditingspersonatingsprophesyingspetitioningsprospectingsprescribingspipefittingsplatformingspolitickingsparapentingspronouncingsparaglidingsPhrases (1)
purse strings
