12-Letter Words Containing: R,A,W,I,N,G
(In Any Order)
There are 85 12 letter words,
60 12 letter phrases and
0 12 letter abbr's with
R,A,W,I,N,G in.
Best Scoring 12 Letter Words With: R,A,W,I,N,G
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
weatherizing | 12 | 28 | verb, adjectivev, adj | |||||
verb • To protect a structure against damage by the weather. noun • A protective coating, or layer of insulation, as on a house or car. | ||||||||
patchworking | 12 | 27 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
workingwoman | 12 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
wisecracking | 12 | 24 | adjectiveadj | |||||
noun • witty remark verb • make a comment, usually ironic | ||||||||
overwatching | 12 | 24 | verbv | |||||
Valid word for Scrabble US
| ||||||||
giftwrapping | 12 | 24 | noun, adjectiven, adj | |||||
verb • To wrap something in decorative wrappings prior to presenting it as a gift | ||||||||
flowcharting | 12 | 24 | verb, nounv, n | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
birdwatching | 12 | 24 | nounn | |||||
verb • watch and study birds in their natural habitat | ||||||||
pawnbrokings | 12 | 24 | ||||||
Valid word for Scrabble US
| ||||||||
wakeboarding | 12 | 23 | verb, nounv, n | |||||
noun • A water sport where a rider on a small board is towed by a motor boat, attached by a cable. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 12 Letter Words
Words (85)
snowboardingbrainwashinghousewarmingheartwarmingwarmongeringmetalworkingbraunschweigunwaveringlynightcrawlerinterweavingcaterwaulingworkingwomanwisecrackingweatherizingwatermarkingwaterloggingwaterfowlingwallpaperingpatchworkingoverwearyingoverwatchinglawbreakingshandwritingsgiftwrappingflowchartingcartwheelingbirdwatchingnewspaperingweaponeeringwaterskiingswakeboardingswaggeringlyspringwatersscrimshawingreswallowingracewalkingsplaywritingspawnbrokingsoverwateringnightwalkershandwringersgranitewaresforeswearingbreadwinninghandwringingwranglershipwoodcarvingswiretappingswiredrawingswhereagainstweatherisingwaveringnesswatchspringswarehousingswarchalkingswallcoveringwaldgravineswaitressingswagonwrightsunwearyinglyunderdrawingreawakeningspowerboatingoverswearingmarrowskyingjawbreakingshairweavingsgreenwashinggladwrappingforwanderingforewarningsdrawlingnessbrowbeatingsblowkartingsworld-shakingworking-classword-paintingwoodgrainingwaggonwrightlower-rankinginward-movinggrayish-brownbrownish-grayawe-inspiringaward-winningPhrases (60)
writing tableworking partywild geraniumwest virginiawatering holewarning lightwalking on airsword dancingstaying powerrough drawingpassing watergift wrappingfrighten awayedward gibbondrawing powerdrawing boardwriting paperwriting boardwrestling matwilliam greenwest germanicweight gainerwedding partywedding marchwatering cartwater partingwarning of warwandering jewwalking horsewage increasevirginia wadethrowing awayswimming crabsurgical gownprairie wagonpower walkingpower loadingnorwegian seanew norwegiannarrow marginlewis h. morganleaning towerguinea flowergrowing painsgenus winteragenus swertiagenus erwiniaflowering ashfire watchingdrawing tabledrawing paperdrawing chalkdrainage wellcedar waxwingbring forwardbrewer's grainbreaking windbreaking awayboiling waterbaking powder