12-Letter Words Containing: E,R,S,H,A,R,P
(In Any Order)
There are 153 12 letter words,
23 12 letter phrases and
0 12 letter abbr's with
E,R,S,H,A,R,P in.
Best Scoring 12 Letter Words With: E,R,S,H,A,R,P
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| xylographers | 12 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| oropharynxes | 12 | 27 | nounn | |||||
noun • The oral part of the pharynx, reaching from the uvula to the level of the hyoid bone. | ||||||||
| hypermarkets | 12 | 26 | nounn | |||||
noun • a huge supermarket (usually built on the outskirts of a town) | ||||||||
| hypercharges | 12 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| xerographies | 12 | 25 | nounn | |||||
noun • forming an image by the action of light on a specially coated charged plate; the latent image is developed with powders that adhere only to electrically charged areas | ||||||||
| hypersurface | 12 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| praiseworthy | 12 | 23 | adjectiveadj | |||||
adjective satellite • worthy of high praise | ||||||||
| typographers | 12 | 23 | nounn | |||||
noun • one who sets written material into type | ||||||||
| polygraphers | 12 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
| choreographs | 12 | 23 | verbv | |||||
verb • compose a sequence of dance steps, often to music • plan and oversee the development and details of | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 12 Letter Words
Words (153)
stratosphereanchorpersonsuperchargedsharpshooterstenographerpraiseworthysuperchargersharecropperspectrographshatterproofscenographerperiphrasticcosmographerxerographiestypographerstrapshooterstopographerssuperchargesstraphangersserigraphersresharpeningrepurchasingpolygraphersparishionersparaphraserspaperhangersoropharyngesholographerscrapshooterschoreographschiropteranschairpersonscardsharpersarthrosporeshairsplitterxylographersthermographstelegrapherssuperheaterssuperhardensstereographystereographssheepshearersharecroppedserigraphiesrenographiespurpleheartspreslaughterprerehearsalprepurchasesprepurchasedprehistorianpredischargepraetorshipsplatyrrhinesphrasemongerphrasemakersphilanderersperchloratespatriarchiespartnershipsparagraphersorthopteransoropharynxeshypersurfacehyperrealisthyperrealismhypermarketshyperchargeshyperboreanshyperarousalhorseplayersgrasshoppersdiscographerdemographerschrysoprasesarthroscopesarchesporiumarchesporialxerographerswranglershiptransshippertranshipperstrachypterussuperteachersuperhumeralspreagheriessonographerssnobographershopbreakerssharpbenderssarrusophonerhabdosphereretrophiliasretainershipreproachlesspyrographiespyrographersprostantheraprehensorialprechristianpreachershipplerophoriasphraseographphraseogramsperiphrasingparrotfishesparaphreniasorthopraxiesoreographiesnosographersnomographersmonographersmimographerslogographerslamprophyreskeratophyreshypersarcomahyperorexiashypercarbiashorripilateshorographieshorographersgastrosophererythropsiasergatomorphsdoxographerscrescographscrepehangerscreatureshipcreatorshipscrapehangerscheeseparerscerographistcerographiescacographersbarophoresisbarophoresesastrospheresareographiesaerographiesweatherstriptrachipterussuperslasherself-reproachrhodosphaerapressure-washpre-christianhypercoasterhire-purchasegastrophrynebarrel-shapedarthropterisPhrases (23)
star sapphireprotest marchhedge sparrowbarbary sheepweather striputtar pradeshturn of phrasetreasure shipspear throwerspark chamberscratch paperprimrose pathpotter's earthpepper shakerpearl fisheryorchestra pitleather striphouse sparrowhorse parsleyharpers ferryharper's ferryhaber processfrench pastry
