12-Letter Words Containing: C,I,L,W
(In Any Order)
There are 38 12 letter words,
53 12 letter phrases and
0 12 letter abbr's with
C,I,L,W in.
Best Scoring 12 Letter Words With: C,I,L,W
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| bewitchingly | 12 | 26 | adverb, adjectiveadv, adj | |||||
adverb • in a bewitching manner | ||||||||
| walkingstick | 12 | 26 | nounn | |||||
noun • any of various mostly tropical insects having long twiglike bodies | ||||||||
| whimsicality | 12 | 25 | nounn | |||||
noun • the trait of acting unpredictably and more from whim or caprice than from reason or judgment • the trait of behaving like an imp | ||||||||
| spacewalking | 12 | 24 | noun, adjectiven, adj | |||||
verb • move in space outside a space craft | ||||||||
| flowcharting | 12 | 24 | verb, nounv, n | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
| microwavable | 12 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| pickerelweed | 12 | 24 | nounn | |||||
noun • American plant having spikes of blue flowers and growing in shallow water of streams and ponds | ||||||||
| blowtorching | 12 | 23 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
| switchblades | 12 | 23 | nounn | |||||
noun • a pocketknife with a blade that springs open at the press of a button | ||||||||
| racewalkings | 12 | 22 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 12 Letter Words
Words (38)
councilwomancowardlinessclownishnessnightcrawlerbewitchinglycaterwaulingwhimsicalityspacewalkinglatticeworksflowchartingcartwheelingblowtorchingswitchbladesracewalkingsmicrowavabledisallowancecouncilwomencauliflowerswalkingstickpickerelweedwildcattingswelwitschiaswarchalkingswallcoveringwallclimbersswivelblocksmajolicawarecurliewurliecripplewarescrewellerieschildcrowingbullwhackingblackwashingworking-classwork-clothingwine-colouredplace-worshiplow-ceilingedPhrases (53)
world councilwilliam clarkwild hyacinthmalawi kwachalow countriesfowling pieceelectric glowdomestic fowldigital watchbowling scorebicycle wheelwriter's blockworks councilwilton carpetwilliam f. codywilhelm reichwild licoricewild cinnamonwild angelicawichita fallswhite saniclewhite pelicanwhite lettucewalking sticktoggle switchswizzle sticksurgical gownsocial workerpickerel weedoptical crownonce in a whilenew caledoniamagical powerlewis carrolllancet windowkarl wernickejudicial writjohn wycliffefinback whaleeskimo curlewdrawing chalkcrew necklinecooling towerclub sandwichcliff swallowcliff dwellerchile tarweedcharles's waincarolina wrencarl wernickecable railwayathletic weararctic willow
