12-Letter Words Containing: C,C,I,I,N,P
(In Any Order)
There are 65 12 letter words,
14 12 letter phrases and
0 12 letter abbr's with
C,C,I,I,N,P in.
Best Scoring 12 Letter Words With: C,C,I,I,N,P
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| pickabacking | 12 | 29 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| placekicking | 12 | 27 | verb, nounv, n | |||||
verb • (in several forms of football) To kick the ball from a stationary position, especially as a means of scoring extra points. noun • The act or skill of taking placekicks. | ||||||||
| chimneypiece | 12 | 26 | nounn | |||||
noun • shelf that projects from wall above fireplace | ||||||||
| amphictyonic | 12 | 26 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| intrapsychic | 12 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| interpsychic | 12 | 24 | ||||||
Valid word for Scrabble US
| ||||||||
| precipitancy | 12 | 23 | nounn | |||||
noun • the quality of happening with headlong haste or without warning | ||||||||
| monospecific | 12 | 23 | adjectiveadj | |||||
adjective • (Of a genus) containing only one known species. • (Of a group of antibodies) with affinity for the same antigen. | ||||||||
| microphonics | 12 | 23 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| conspecifics | 12 | 23 | nounn | |||||
adjective • belonging to the same species noun • an organism belonging to the same species as another organism | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 12 Letter Words
Words (65)
complicationcomplicatingconscriptionincapacitatepacificationnecrophiliacresipiscenceiconographicencephalitictranspacificprecipitancyprecipitancechimneypiecepickabackingpercipiencesincapacitiesconspiraciesconscriptingaccipitrinespreconciliarplacekickingnucleophilicmonospecificmicrophonicsintrapsychicinterpsychicincipienciesdiencephaliccorecipientscoprincipalsconspecificscomplianciescocaptainingchaplainciescapacitationcapacitatingamphictyonicchloropicrinzincographicretinoscopicresipiscencyrecipienciespycnoconidiaproficiencespicrocarminepiccaninniesphotoactinicpacificatingmicrocopyinginoccupationincompliancyincomplianceincapacitantimpeccanciesichnographiccondisciplescircumposingciclosporinschlorpicrinstechnophilicpucciniaceaeprospicienceprocyclidineplace-kickingpatricentricPhrases (14)
price cuttingpolice actionicing the puckcaptain hicksacrylic paintprivy councilpicnic groundphenylic acidpacific oceannorth pacificclosing pricecephalic veincapacity unitauction pitch
