12-Letter Words Containing: A,L,P,I,N,G,S
(In Any Order)
There are 103 12 letter words,
37 12 letter phrases and
0 12 letter abbr's with
A,L,P,I,N,G,S in.
Best Scoring 12 Letter Words With: A,L,P,I,N,G,S
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
plasmolyzing | 12 | 29 | verbv | |||||
verb • To cause, or to undergo plasmolysis | ||||||||
specializing | 12 | 26 | verb, adjectivev, adj | |||||
verb • become more focused on an area of activity or field of study • be specific about • suit to a special purpose • devote oneself to a special area of work • evolve so as to lead to a new species or develop in a way most suited to the environment | ||||||||
plasticizing | 12 | 26 | verb, adjectivev, adj | |||||
verb • become plastic, as by having a plasticizer added • make plastic, as by the addition of a plasticizer | ||||||||
backslapping | 12 | 25 | noun, adjectiven, adj | |||||
verb • display excessive cordiality (towards) | ||||||||
spacewalking | 12 | 24 | noun, adjectiven, adj | |||||
verb • move in space outside a space craft | ||||||||
sleepwalking | 12 | 22 | noun, adjectiven, adj | |||||
noun • walking by a person who is asleep | ||||||||
playwritings | 12 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
platemakings | 12 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
pugnaciously | 12 | 20 | adverbadv | |||||
adverb • in a pugnacious manner | ||||||||
haptoglobins | 12 | 20 | nounn | |||||
noun • a protein in plasma that binds free hemoglobin and removes it (as from wounds) | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 12 Letter Words
Words (103)
sleepwalkingspecializingspecialisingdespairinglysupplicatingbackslappingsurpassinglypalingenesisearsplittingspacewalkingplasticizingplasmolyzingparasailingspalingenesesoutsparklingpugnaciouslypleasingnesstailspinningspeedballingreplasteringredisplayingpresignalledpresignalingprereleasingpopularisingplaywritingsplatemakingsplasminogensplantigradesplagiarisingpelargoniumspedestallingpalynologistpalynologieshaptoglobinsgeneralshipsgallinipperscapitalisingappraisinglywranglershipwhipstallingunpleasinglyunaspiringlysulphuratingsulphonatingsporangiolumsporangiolesspiflicatingsphacelatingspaniolizingspaniolisingspaniolatingsaprolegniasrepolarisingpsalmodizingpsalmodisingpostillatingpolygamisingplumbaginousplatformingsplasticisingplasmolysingphilologiansphaenologiespatrialisingpartialisingparalysinglyparalogisingparallelingsparaglidingsparabolisingpalsgravinespalingenesiapalatalisingoptimalisingmispleadingslandskippinggoalkeepingsfingerplatesemplasteringdisculpatingdepolarisingcomplainingschaptalisingbipolarisingbeplasteringaquaplaningsappleringiesappetisinglyapostolizingapostolisingantigropelosanglophobiasanglophiliasangiospermalalphasortingspring-loadedspongioblastspongillaflysingle-spacedmarlingspikemagnoliopsidlymphangitisPhrases (37)
wake-up signalshopping mallshell platingshaking palsyplant closingplain sailingoutput signalnesting placelanding stripgenus primulagenus lepismagenus lepiotastamping millsporting ladyspiral springspecial agentsparking plugsleep talkingsampling ratepopulus nigraplace settingnaples garliclinus paulinggiant scallopgenus xylopiagenus tilapiagenus thlaspigenus spirulagenus pyralisgenus perillagenus liparisgenus lamprisgenus aplysiagenus alpiniagenus alopiusgenital phasegasoline pump