12-Letter Words Containing: A,I,K,R,R
(In Any Order)
There are 44 12 letter words,
51 12 letter phrases and
0 12 letter abbr's with
A,I,K,R,R in.
Best Scoring 12 Letter Words With: A,I,K,R,R
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
kwashiorkors | 12 | 26 | nounn | |||||
noun • severe malnutrition in children resulting from a diet excessively high in carbohydrates and low in protein | ||||||||
merrymakings | 12 | 24 | nounn | |||||
noun • a boisterous celebration; a merry festivity | ||||||||
crackbrained | 12 | 23 | adjectiveadj | |||||
adjective satellite • insanely irresponsible | ||||||||
headshrinker | 12 | 23 | nounn | |||||
noun • A psychiatrist. | ||||||||
wisecrackers | 12 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
firecrackers | 12 | 23 | nounn | |||||
noun • firework consisting of a small explosive charge and fuse in a heavy paper casing | ||||||||
blackbirders | 12 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
windbreakers | 12 | 22 | noun, adjectiven, adj | |||||
noun • a kind of heavy jacket | ||||||||
watermarking | 12 | 22 | nounn | |||||
noun • a line marking the level reached by a body of water • a distinguishing mark impressed on paper during manufacture; visible when paper is held up to the light | ||||||||
stringybarks | 12 | 22 | nounn | |||||
noun • any of several Australian eucalypts having fibrous inner bark | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 12 Letter Words
Words (44)
kindergartenracketeeringcrackbrainedheadshrinkerrickenbackerwisecrackerswindbreakerswatermarkingtrailbreakerpremarketingperestroikasmerrymakingsfirecrackersboilermakerstrademarkingstringybarkskwashiorkorsblackbirdersblackberriesskrimshankerskimboarderssharemilkersseraskieraterijksdaalersmicrocrackedmarrowskyinglarrikinismskirschwasserfarnarkelingcrakeberriescrackberriesbrankursinesblackberriedaerobrakingsstaurikosaurscrimshankerparkeriaceaenerve-rackinglower-rankingknight-errantkeratoiritiskeratodermiahead-shrinkercircular-knitPhrases (51)
yom kippur warworking partytruck traffictruck farmingtrailer truckprice bracketperuvian barkpatrick henryliterary workimage breakergerard kuiperfrank sinatrafrancis drakedramatic workdavid garrickboris karloffwhite croakerwater hickoryuss merrimackunpaid workertrick or treatstrike leaderstrike a chordsocial workerservice breakserial killerrocking chairrock geraniumretail marketrequiem sharkprairie smokepickle barrelparking meterparking brakemilitary rankmemorial parkmary pickfordliterary hacklake superiorkorean straitklamath riverkarl wernickekanawha riverink cartridgegray kingbirdfrancis crickeastern turkicarl wernickebreaker pointbrake failureandrei markov