12-Letter Words Containing: A,C,G,I,N,W
(In Any Order)
There are 33 12 letter words,
16 12 letter phrases and
0 12 letter abbr's with
A,C,G,I,N,W in.
Best Scoring 12 Letter Words With: A,C,G,I,N,W
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
bushwhacking | 12 | 30 | verb, nounv, n | |||||
adjective satellite • lying in ambush | ||||||||
paddywacking | 12 | 29 | verbv | |||||
Valid word for Scrabble US
| ||||||||
patchworking | 12 | 27 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
watchmakings | 12 | 27 | ||||||
Valid word for Scrabble US
| ||||||||
walkingstick | 12 | 26 | nounn | |||||
noun • any of various mostly tropical insects having long twiglike bodies | ||||||||
wisecracking | 12 | 24 | adjectiveadj | |||||
noun • witty remark verb • make a comment, usually ironic | ||||||||
watchdogging | 12 | 24 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
spacewalking | 12 | 24 | noun, adjectiven, adj | |||||
verb • move in space outside a space craft | ||||||||
overwatching | 12 | 24 | verbv | |||||
Valid word for Scrabble US
| ||||||||
flowcharting | 12 | 24 | verb, nounv, n | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 12 Letter Words
Words (33)
braunschweignightcrawlerbushwhackingcaterwaulingwainscottingwisecrackingwatchdoggingwainscotingsspacewalkingpatchworkingoverwatchingflowchartingcartwheelingbirdwatchingwatchmakingsscrimshawingracewalkingspaddywackingwalkingstickwoodcarvingswildcattingswatchspringswarchalkingswallcoveringwaistcoatingtownscapingsnewscastingsnewsagenciesdoomwatchingcockswainingbullwhackingblackwashingworking-classPhrases (16)
sword dancinghunting watchwild angelicawest germanicwedding marchwatering cartwashington d.c.walking stickwage increaseswinging chadswimming crabsurgical gownfire watchingdrawing chalkcedar waxwingacademic gown