11-Letter Words Containing: W,H,I,R,S
(In Any Order)
There are 157 11 letter words,
40 11 letter phrases and
0 11 letter abbr's with
W,H,I,R,S in.
Best Scoring 11 Letter Words With: W,H,I,R,S
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
weatherizes | 11 | 26 | verbv | |||||
verb • To protect a structure against damage by the weather. | ||||||||
shipwrecked | 11 | 26 | adjectiveadj | |||||
noun • a wrecked ship (or a part of one) • an irretrievable loss • an accident that destroys a ship at sea verb • ruin utterly • suffer failure, as in some enterprise • cause to experience shipwreck • destroy a ship | ||||||||
workmanship | 11 | 25 | nounn | |||||
noun • skill in an occupation or trade | ||||||||
whichsoever | 11 | 25 | adjectiveadj | |||||
pronoun • (interrogative) Which ever; emphatic form of 'which'. • Irrespective of the one(s) that; no matter which one(s). • Any or either one(s) that; the one(s) that. • Any or either one(s). • According to or depending upon which one(s). | ||||||||
kwashiorkor | 11 | 25 | noun, adjectiven, adj | |||||
noun • severe malnutrition in children resulting from a diet excessively high in carbohydrates and low in protein | ||||||||
highbrowism | 11 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
bewhiskered | 11 | 24 | adjectiveadj | |||||
adjective satellite • having hair on the cheeks and chin | ||||||||
witchcrafts | 11 | 24 | nounn | |||||
noun • the art of sorcery | ||||||||
brightworks | 11 | 24 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
housewifery | 11 | 23 | nounn | |||||
noun • the work of a housewife | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words
Words (157)
brainwashedswitchboardworkmanshipstewardshipwitherspoonghostwriterwisenheimerwarehousingbrainwasherhousewiferywiddershinsbewhiskeredworshippingworshipperswithindoorswhichsoeverweatherizeswasheteriasunworthiestswordfishesswitcheroossweatshirtsshipwrightsshipwreckedscrimshawedplaywrightsmillwrightshoodwinkersforeshowingbrainwashesstraightwaykwashiorkorworshiplessworkaholicswithholderswithershinswithdrawalswitchcraftswhitewasherwhitebeardswhisperingswhirlybirdswheelchairswharfingersweatheringswashateriaswardenshipswainwrightsviewershipsswitchyardsswitchgrassstitchwortssomewhithershortwavingshirtwaistsseaworthierschwarmereireshoweringrainwashingpinwrenchesoverweightsotherwhilesmisthrowingmicroswitchhighbrowismheadwaitersgrowthinessghostwritesfisherwomenfisherwomandownhillersdishwasherscrawfishingbrownshirtsbrightworksbirdwatchesathwartshipworkaholismswarthinessbreadthwisewritershipswreckfishesworshipablewordishnesswoodshrikeswithdrawerswitchbroomswinchesterswillowherbswhorishnesswhitterickswhitethornswhiteboardswhiskerandowhirlblastswhirlaboutswhinberrieswhimperingswhimberrieswhiggamoreswhifflerieswhaikoreroswerewolfishweighboardsweatherisesweatherisedwatchspringwardershipswaiterhoodstsesarewichthwartshipsswitchoversswitchgirlsswitchgearsstrawweightstitchworkssightworthysidewheelershowerinesssharawaggissharawadgisscowtheringprintwheelsmisworshipslukewarmishjinrickshawhitherwardshillwalkersforeshewingelsewhitherdrowsiheadsdreamwhilesdownshifterditchwatersdisworshipscowardshipschequerwisecheesewringcheesewirescesarewitchcartwrightsword-worshipwithstanderwhiskerlesswater-shieldunwished-fortree-worshipsilver-whiteside-wheelershort-wingedshort-windedself-worshipmoon-worshiphero-worshipfish-worshipfire-worshipbrownish-redPhrases (40)
witches' brewwhite personwhiskey sourweather sidesea crawfishnew hebridesira gershwinidol worshipharris tweedcornish fowlwhite squirewhite sprucewhite slaverwhite russiawhisker jackwelsh rabbitweather shipwash drawingwalker smithwaist anchorwabash rivervariety showswivel chairswitch grassswedish ironsolway firthsnowy orchidshowy orchisrainbow fishpicture showirish whiskyinbus wrenchgross weightfishing wormfish chowderferris wheeldress whitescrawfish outcorn whiskeybridge whist