11-Letter Words Containing: T,Y,R,A,N,S
(In Any Order)
There are 135 11 letter words,
30 11 letter phrases and
0 11 letter abbr's with
T,Y,R,A,N,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
tyrannizers | 11 | 23 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
questionary | 11 | 23 | nounn | |||||
noun • A questionnaire. • One who makes it his business to seek after relics and carry them about for sale. adjective • Inquiring; asking questions; testing. | ||||||||
oxygenators | 11 | 22 | nounn | |||||
noun • Any device that releases oxygen (or air) into water, especially one in an aquarium | ||||||||
misanthropy | 11 | 21 | nounn | |||||
noun • hatred of mankind • a disposition to dislike and mistrust other people | ||||||||
tryptophans | 11 | 21 | nounn | |||||
noun • an amino acid that occurs in proteins; is essential for growth and normal metabolism; a precursor of niacin | ||||||||
pyracanthas | 11 | 21 | nounn | |||||
noun • any of various thorny shrubs of the genus Pyracantha bearing small white flowers followed by hard red or orange-red berries | ||||||||
craftsmanly | 11 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
stringybark | 11 | 21 | noun, adjectiven, adj | |||||
noun • any of several Australian eucalypts having fibrous inner bark | ||||||||
stenography | 11 | 20 | nounn | |||||
noun • a method of writing rapidly using an abbreviated symbolic system • the act or art of writing in shorthand | ||||||||
unseaworthy | 11 | 20 | adjectiveadj | |||||
adjective • unfit for a voyage | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words
Words (135)
personalitysingularitycrystallinesedimentaryrhinoplastyancestrallytyrannosaurgrandiosityantislaverypresentablymisanthropyinspiratorystenographystartlinglytreasonablystipendiaryobservantlyinsalubritycosignatoryconsolatoryvineyardisttyrannouslytyrannizerstyrannisingtrypanosometravestyingtranslatorytorsionallythysanuranssyndicatorsstratifyingresultantlypanegyristsoverstayingmonocrystalhoneyeatersarrestinglyunseaworthytransientlyinscrutablyuncustomarytyrosinasestryptophanstryptaminestapestryingsyncopatorssubcontrarysportsmanlyquestionarypyracanthaspresynapticprepaymentspredynasticphalansterypatronymicsoxygenatorsmenstruallymatronymicsinterlayershypertoniashairstylingdesignatorycystinuriascraftsmanlyantisecrecyantipyrinesantileprosystringybarkpharyngitiscountryseatastringencyunbirthdaystyranniserstyrannessesthysanurousthermonastytetragynoustestudinarysymmetrianssylvestriansycophantrysuperdaintysuburbanitystreaminglysmartypantssinistrallyseditionarysedentarilysaturninitysaturninelysalinometryrinsabilitypresanctifyparoxytonespantrymaidsobsignatorynotaryshipsmartyrisingkarstifyinginsinuatoryhyperbatonshypaethronshyoplastronhydrastinesgastromancyergatogynesdynamitardsdisentrayledefraymentscyanometerscorybantismcanterburysbarycentresattorneyismasynarteticasynartetesastrobotanyarytaenoidsantipyresesantibaryonsagrypnoticsvestrywomanuranoplastytyrosinemiatranslunarythysanoptersyncreticalselenolatrypolyandristneuroplastykyrgyzstanihydromanteschristianlyastrophytonantipyresisPhrases (30)
veterans' daysyntax errorsubway traingenus styraxgenus ostryaeaster bunnybody servantworsted yarnwest germanyveterans dayurban typhusthorny skatesunray pleatroyal tennisrhus typhinaoyster plantovarian cystnyquist ratenorth by eastnature studygranny smithgenus merytaflying startenergy stateeast germanyeast by northdrain systemcrested mynaautumn yearsanti-sway bar