11-Letter Words Containing: S,A,N,E,L,Y
(In Any Order)
There are 158 11 letter words,
30 11 letter phrases and
0 11 letter abbr's with
S,A,N,E,L,Y in.
Best Scoring 11 Letter Words With: S,A,N,E,L,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| anaphylaxes | 11 | 26 | nounn | |||||
noun • hypersensitivity reaction to the ingestion or injection of a substance (a protein or drug) resulting from prior contact with a substance | ||||||||
| expansively | 11 | 26 | adverb, adjectiveadv, adj | |||||
adverb • in an impressively expansive manner • in an ebullient manner | ||||||||
| inexcusably | 11 | 25 | adverb, adjectiveadv, adj | |||||
adverb • in an unpardonable manner or to an unpardonable degree • without any excuse | ||||||||
| subjacently | 11 | 25 | ||||||
Valid word for Scrabble US
| ||||||||
| mesenchymal | 11 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| unspeakably | 11 | 22 | adverb, adjectiveadv, adj | |||||
adverb • to an inexpressible degree | ||||||||
| misshapenly | 11 | 21 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| thanklessly | 11 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| hyperplanes | 11 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| assemblyman | 11 | 20 | nounn | |||||
noun • someone who is a member of a legislative assembly | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 11 Letter Words
Words (158)
personalitynecessarilyessentiallydangerouslyuniversallyincessantlyassemblymancrystallineunspeakablyplayfulnessunabashedlyobstinatelyancestrallyunceasinglyunashamedlyinescapablywensleydaleantislaveryundesirablysecondarilypresentablyinexcusablyunadvisedlytenaciouslyscreaminglytreasonablysuperlunaryobservantlygrandioselydauntlesslystainlesslyseasonalityscreenplaysresultantlymisshapenlylarcenouslyinsatiatelyinestimablyhydroplanescaressinglybrainlesslybarleycornsassemblymenarrestinglytransientlysearchinglyinseparablyinsensatelycommensallytypicalnessthanklesslysynaloephassustainedlysubjacentlysensoriallysemitonallysegmentallysectionallyraylessnesspolyandriesphalansterypennyroyalsmisanalysesmetanalysismetanalysesmesenchymalmenstruallymelanocytesmasculinelylyricalnessladyfingersinterlayershypersalinehyperplanesfestinatelyerosionallyendosteallyencyclicalsdelusionarydailynessescutaneouslycavernouslycancerouslyascendantlyantileprosyanaphylaxesabstinentlystatesmanlysalmonberrynefariouslyinsuperablyexpansivelyyaffingalesunshakeablyunisexuallyuniseriallyunderlayersunbiassedlytensionallytaintlesslysyntecticalsynsepaloussylvestrianstreaminglysqueakinglyspreadinglyslaveringlysexenniallysessionallysedentarilysaturninelysalinometryreanalysingpolysemantspentastylespalingenesypaddymelonsoverlayingsoveranalyseloyalnessesloadsamoneylauncegayesincreasedlyhyalophaneshyalomelanshaemolysinsglyoxalinesethylationsethylaminesdrainlayersdispensablydisentraylediscernablydelayeringscynicalnesscorydalinesconversablycontestablyassentinglyappeasinglyanaglyphiesammonolysesacotyledonswesleyanismunsyllabledsyntheticalsyncreticalspiny-leavedspiny-leafedsnakeblennyselenolatrypolygonalesplatystemonneuroplastylady's-fingercoalescencyclayishnesschelyabinskPhrases (30)
lower saxonylevy en masselaying wastegolden yearsglossy snakegenus lycosayellow avenstonal systemsunray pleatstay in placesoybean milksoybean mealsoyabean oilsolar energysilly seasonsalmon berryroyal tennispansy violetoyster plantleyte islandgenus pyrolagenus lyoniagenus alytesfantasy lifedry cleanersconey islandbeauty salonbay of naplesalfred noyesabyssal zone
