11-Letter Words Containing: I,S,P,L,A,Y
(In Any Order)
There are 146 11 letter words,
11 11 letter phrases and
0 11 letter abbr's with
I,S,P,L,A,Y in.
Best Scoring 11 Letter Words With: I,S,P,L,A,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| prophylaxis | 11 | 28 | nounn | |||||
noun • the prevention of disease | ||||||||
| polygamizes | 11 | 28 | ||||||
Valid word for Scrabble US
| ||||||||
| hypophysial | 11 | 27 | ||||||
adjective • of or relating to the hypophysis | ||||||||
| psychically | 11 | 26 | adverb, adjectiveadv, adj | |||||
adverb • from a psychic point of view | ||||||||
| anaphylaxis | 11 | 26 | nounn | |||||
noun • hypersensitivity reaction to the ingestion or injection of a substance (a protein or drug) resulting from prior contact with a substance | ||||||||
| phyllotaxis | 11 | 26 | nounn | |||||
noun • The arrangement of leaves on a stem, or the mathematical principles governing such arrangement. | ||||||||
| expansively | 11 | 26 | adverb, adjectiveadv, adj | |||||
adverb • in an impressively expansive manner • in an ebullient manner | ||||||||
| polyzoaries | 11 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| physicality | 11 | 24 | nounn | |||||
noun • preoccupation with satisfaction of physical drives and appetites | ||||||||
| hypoplastic | 11 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 11 Letter Words
Words (146)
personalityhospitalityspirituallypyroclasticsphericallyphysicalitypsychicallyrhinoplastypsychedeliageophysicalhypoplasticbiophysicalangioplastyinescapablyunsparinglyskepticallyscepticallyrapaciouslynonphysicalanaphylaxisprophylaxisimplausiblyhyperplasiaspasmolyticphysicalismhypophysialcytoplasmicsuppliantlyspasticallypostholidayplaywrightsphyllotaxismisshapenlymisapplyingdisplayablecyclopediascalypsonianplasticallypervasivelyinseparablyimpassivelytypicalnesssympetaliesstaphylinidspecularityredisplayedpolyzoariespolyphagiespolyphagiaspolynomialspolymathiespolygamizespolygamistspolydipsiaspolycarpiespolyandriesplaymakingsplayactingsplatyfishesplasmolyticplasmolysisphysicalistnyctalopiashypoplasiashypersalinegypsophilasepiscopallydisparatelycapaciouslybasipetallybaptismallyasepticallyantileprosysuperfamilystipulatoryspiritualtyprosaicallyinsuperablyexpansivelycallipygousunplausiblysyphilomatasympodiallysyllepticalstaphylitisspreadinglysparklinglysialographysemelparitypyrolatriespulsativelypulsatilitypsychodeliapsaligraphypolymastismpolymastiespolymastiaspolyhalitespolygamisespolygamisedpolychasiumpolybasitespolyarchiespollyannishplaylistingphysiolatryphysiolaterphylarchiespassibilityparalympicspalingenesyoviparouslylithophysaeithyphallushypoblastichyperduliashypalgesiashylopathisthylopathismhalophytismdyspepticaldropsicallydispensablydisapplyingcynophiliascrapulositycalotypistsaspersivelyappulsivelyappeasinglyanisophyllyanaglyphiesampullosityspiny-leavedspiny-leafedspectralityspasmolysispolyandristplatichthyslady-slipperhypericaleserysiphalesdactylopiuscytoplasticcystoplegiaamphistylarPhrases (11)
sylvia plathspecial juryship's galleypassion playdisplay casewild parsleystay in placespiny lizardsitar playerpassing playpansy violet
