11-Letter Words Containing: H,E,R,D,I,C,S
(In Any Order)
There are 65 11 letter words,
10 11 letter phrases and
0 11 letter abbr's with
H,E,R,D,I,C,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
shipwrecked | 11 | 26 | adjectiveadj | |||||
noun • a wrecked ship (or a part of one) • an irretrievable loss • an accident that destroys a ship at sea verb • ruin utterly • suffer failure, as in some enterprise • cause to experience shipwreck • destroy a ship | ||||||||
hypodermics | 11 | 24 | nounn | |||||
adjective • relating to or located below the epidermis noun • a piston syringe that is fitted with a hypodermic needle for giving injections | ||||||||
scrimshawed | 11 | 22 | verb, adjectivev, adj | |||||
verb • To make an item of scrimshaw. • To engrave fanciful designs on (shells, whales' teeth, etc.). | ||||||||
birdwatches | 11 | 22 | ||||||
Valid word for Scrabble US
| ||||||||
archduchies | 11 | 22 | noun, adjectiven, adj | |||||
noun • the domain controlled by an archduke or archduchess | ||||||||
chrysomelid | 11 | 22 | noun, adjectiven, adj | |||||
noun • brightly colored beetle that feeds on plant leaves; larvae infest roots and stems | ||||||||
comradeship | 11 | 21 | nounn | |||||
noun • the quality of affording easy familiarity and sociability | ||||||||
chemisorbed | 11 | 21 | verb, adjectivev, adj | |||||
verb • take up a substance by chemisorption | ||||||||
dichroscope | 11 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
disbranched | 11 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words
Words (65)
merchandisechristendomschrodingerarchdioceseorthopedicscomradeshipshipwreckedscrimshawedsaccharideshypodermicsdispatchersdischargersdeciphererschemisorbedechinodermsdischargeesdisbranchesdisbrancheddichroscopedichromatesdiachronieschrysalideschiropodieschandlerieschandelierscantharidesbirdwatchesarchduchiesachondritesicosahedronicosahedralchrysomelidtrichinosedtrichinisedsubchloridestrychninedsaccharizedsaccharisedprincehoodsmonarchisedhinderancesditchwatersdischurchesdischurcheddisanchoreddichloridescirrhipedeschondrifieschlorinisedchloridizeschloridiseschloridisedchloridatesbrickshapedbichloridesadhocraciesthickspreadhystricidaeharsh-voicedfoster-childcigar-shapedchrysopidaecherry-sizedbrick-shapedblackish-redPhrases (10)
third sackersecond reichposter childpercoid fishdrove chiselstreet childred rockfishoil-rich seedfish chowdercecil rhodes