11-Letter Words Containing: D,A,S,H,I,E,R
(In Any Order)
There are 170 11 letter words,
10 11 letter phrases and
0 11 letter abbr's with
D,A,S,H,I,E,R in.
Best Scoring 11 Letter Words With: D,A,S,H,I,E,R
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| rhapsodized | 11 | 27 | verbv | |||||
verb • recite a rhapsody • say (something) with great enthusiasm | ||||||||
| rhapsodizes | 11 | 26 | verbv | |||||
verb • recite a rhapsody • say (something) with great enthusiasm | ||||||||
| scrimshawed | 11 | 22 | verb, adjectivev, adj | |||||
verb • To make an item of scrimshaw. • To engrave fanciful designs on (shells, whales' teeth, etc.). | ||||||||
| hypermedias | 11 | 22 | nounn | |||||
noun • a multimedia system in which related items of information are connected and can be presented together | ||||||||
| birdwatches | 11 | 22 | ||||||
Valid word for Scrabble US
| ||||||||
| archduchies | 11 | 22 | noun, adjectiven, adj | |||||
noun • the domain controlled by an archduke or archduchess | ||||||||
| comradeship | 11 | 21 | nounn | |||||
noun • the quality of affording easy familiarity and sociability | ||||||||
| driveshafts | 11 | 21 | nounn | |||||
noun • a rotating shaft that transmits power from the engine to the point of application | ||||||||
| dishwashers | 11 | 21 | nounn | |||||
noun • a machine for washing dishes • someone who washes dishes | ||||||||
| brainwashed | 11 | 20 | verb, adjectivev, adj | |||||
adjective • subjected to intensive forced indoctrination resulting in the rejection of old beliefs and acceptance of new ones | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 11 Letter Words
Words (170)
hairdressermerchandisebrainwashedhorseradisharchdiocesestewardshipnearsightedcomradeshipdiaphoresisuntarnishedunvarnishedungarnishedspringheadsspearfishedscrimshawedsaccharidesrevarnishedrefashionedpathfindersovershadinghinterlandshighlandersdispatchersdisheartensdisenthralsdisenthralldischargersdiaphoresesbridgeheadsarthritidesadmonishersarthrodesiswhitebeardswardenshipstranshippedtimberheadsshorthairedshirttailedshadberriesrhapsodizesrhapsodizedreadershipsradiophonesmaidenhairsleadershipshypermediashydrastiseshusbandriesheadwaitersheadspringshardinessesfigureheadsdriveshaftsdraughtiestdishwashersdischargeesdisbranchesdisbrancheddiphtheriasdichromatesdiathermiesdiarthrosesdiaphorasesdiachroniesdealershipschrysalideschandlerieschandelierscantharidesblandishersbirdwatchesarchduchiesachondritesthreadinessmithridatesicosahedronicosahedralbreadthwisewithdrawerswhiteboardswhiskerandoweighboardsweatherisedwardershipswaiterhoodstrihydratestradershipsthirdstreamthermalisedthenarditessubahdariesstarlightedsphaeridiumshieldrakessherardizessherardizedsherardisessherardisedsaccharizedsaccharisedrhapsodisesrhapsodisedrehumanisedrehandlingsrankshiftedpreadmonishperiphrasedorthopediasmonarchisedloudhailerslethargisedjerkinheadsisodiaphereinterdashesinterdashedhysteroidalhyperduliashydrastineshitherwardshistoriatedhirudineanshinderlandshinderancesheraldshipsheparinisedhansardizeshansardizedhansardiseshansardisedhamstringedhalberdiersgraphitisedgrandeeshipfoolhardisedrowsiheadsdrosophilaedrearihoodsdreariheadsdreamwhilesditchwatersdisanchoreddiathermousdiathermiasdegarnishesdegarnishedchloridatesbrickshapedbrandishersadvisershipadhocracieswithstanderwater-shieldthickspreadstiff-hairedsnake-hairedsilky-hairedsightreadershort-tailedshort-hairedsharp-limbedreddish-grayorangish-redhystricidaehermissendaharsh-voicedhair-shirtedcigar-shapedchrysopidaebrick-shapedblackish-redPhrases (10)
weather sidethird sackerthird estateharris tweeddasht-e-kavirdanish kronerhode islandred goatfishlisle threadhorse radish
