11-Letter Words Containing: C,H,I,M,L,A
(In Any Order)
There are 115 11 letter words,
18 11 letter phrases and
0 11 letter abbr's with
C,H,I,M,L,A in.
Best Scoring 11 Letter Words With: C,H,I,M,L,A
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
mycorrhizal | 11 | 30 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
alchemizing | 11 | 28 | verb, adjectivev, adj | |||||
verb • alter (elements) by alchemy | ||||||||
hypokalemic | 11 | 27 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
schmalziest | 11 | 27 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
schmaltzier | 11 | 27 | ||||||
adjective • Overly sentimental, emotional, maudlin or bathetic. | ||||||||
hexadecimal | 11 | 26 | noun, adjectiven, adj | |||||
adjective • of or pertaining to a number system having 16 as its base | ||||||||
cyclothymia | 11 | 26 | nounn | |||||
noun • a mild bipolar disorder that persists over a long time | ||||||||
amphiphilic | 11 | 25 | adjectiveadj | |||||
adjective • (of a molecule) Being a detergent: having both hydrophilic and hydrophobic (or lipophilic) groups. • (of a protein, especially an alpha helix) Having one surface consisting of hydrophilic amino acids and the opposite surface consisting of hydrophobic (or lipophilic) ones. | ||||||||
hippocampal | 11 | 24 | adjectiveadj | |||||
adjective • Pertaining to the hippocampus. | ||||||||
whimsically | 11 | 24 | adverb, adjectiveadv, adj | |||||
adverb • in a fanciful manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words
Words (115)
chamberlainbiochemicalmelancholiccatholicismmachiavellimelancholiaathleticismmultiphasichemophiliachypokalemicmonarchicallogarithmicalgorithmicimpeachablehomicidallyhippocampalmatriarchalwhimsicallyphysicalismmachinelikehexadecimalnonchemicalmycorrhizallogomachiesepithalamicchameleonicblacksmithsamphiphilicalchemizingtrichomonalthermicallythalassemicschmalziestschmaltzierphallicismsmyelopathicmonochasialmischannelsmetaethicalmechanicalsmarshalciesmanchineelsmachineablehomothallichomoplastichemiacetalshalomorphicgeochemicalcologarithmchloraminescallithumpsalcoholismshomologicalhomileticalhematologiccyclothymiacatechismalallomorphicalchemisticzoochemicalthermoticalthalictrumsstomachicalschoolmaidsschlimazelsschematicalrheumaticalpolychasiumphocomeliasphilomathicmoustachialmischmetalsmicrocephalmethacrylicmelanochroimailpouchesmailcoachesmachinelessleuchaemiaslagomorphicisocheimalsimpleachinghomoblastichemistichalhemeralopichegemonicalharmolodicseurythmicalempleachingdicephalismclubmanshipcholiambicschloralismschemurgicalbachelorismasthmaticalarchiplasmsalphameticsalchemisingphilomachusmalacophilymail-cheekedmachicolatelogomachistlithomanticlithomancerhalchidhomahaemophilicchloramine-tchilomastixchampollioncampephiluscallimorphabrahminicalamelanchierPhrases (18)
line of marchlamp chimneyfemale childslot machinepalma christochna familymiddle watchmanna lichenmachine toolmachine boltharmonic lawfluid drachmflame stitchdimpled chadchilean rimubirch familybeech familya. a. michelson