11-Letter Words Containing: C,H,I,D,E,R,S
(In Any Order)
There are 65 11 letter words,
10 11 letter phrases and
0 11 letter abbr's with
C,H,I,D,E,R,S in.
Best Scoring 11 Letter Words With: C,H,I,D,E,R,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| shipwrecked | 11 | 26 | adjectiveadj | |||||
noun • a wrecked ship (or a part of one) • an irretrievable loss • an accident that destroys a ship at sea verb • ruin utterly • suffer failure, as in some enterprise • cause to experience shipwreck • destroy a ship | ||||||||
| hypodermics | 11 | 24 | nounn | |||||
adjective • relating to or located below the epidermis noun • a piston syringe that is fitted with a hypodermic needle for giving injections | ||||||||
| scrimshawed | 11 | 22 | verb, adjectivev, adj | |||||
verb • To make an item of scrimshaw. • To engrave fanciful designs on (shells, whales' teeth, etc.). | ||||||||
| birdwatches | 11 | 22 | ||||||
Valid word for Scrabble US
| ||||||||
| archduchies | 11 | 22 | noun, adjectiven, adj | |||||
noun • the domain controlled by an archduke or archduchess | ||||||||
| chrysomelid | 11 | 22 | noun, adjectiven, adj | |||||
noun • brightly colored beetle that feeds on plant leaves; larvae infest roots and stems | ||||||||
| comradeship | 11 | 21 | nounn | |||||
noun • the quality of affording easy familiarity and sociability | ||||||||
| chemisorbed | 11 | 21 | verb, adjectivev, adj | |||||
verb • take up a substance by chemisorption | ||||||||
| dichroscope | 11 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| disbranched | 11 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 11 Letter Words
Words (65)
merchandisechristendomschrodingerarchdioceseorthopedicscomradeshipshipwreckedscrimshawedsaccharideshypodermicsdispatchersdischargersdeciphererschemisorbedechinodermsdischargeesdisbranchesdisbrancheddichroscopedichromatesdiachronieschrysalideschiropodieschandlerieschandelierscantharidesbirdwatchesarchduchiesachondritesicosahedronicosahedralchrysomelidtrichinosedtrichinisedsubchloridestrychninedsaccharizedsaccharisedprincehoodsmonarchisedhinderancesditchwatersdischurchesdischurcheddisanchoreddichloridescirrhipedeschondrifieschlorinisedchloridizeschloridiseschloridisedchloridatesbrickshapedbichloridesadhocraciesthickspreadhystricidaeharsh-voicedfoster-childcigar-shapedchrysopidaecherry-sizedbrick-shapedblackish-redPhrases (10)
third sackersecond reichposter childpercoid fishdrove chiselstreet childred rockfishoil-rich seedfish chowdercecil rhodes
