11-Letter Words Containing: A,L,E,V,E,L
(In Any Order)
There are 59 11 letter words,
32 11 letter phrases and
0 11 letter abbr's with
A,L,E,V,E,L in.
Best Scoring 11 Letter Words With: A,L,E,V,E,L
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| polyvalence | 11 | 21 | nounn | |||||
noun • (chemistry) the state of having a valence greater than two • (toxicology) the state of being capable of counteracting more than one toxin or antigen or kind of microorganism | ||||||||
| vexillaries | 11 | 21 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
| viceregally | 11 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| levelheaded | 11 | 19 | adjectiveadj | |||||
adjective satellite • exercising or showing good judgment | ||||||||
| prevalently | 11 | 19 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| developable | 11 | 19 | adjectiveadj | |||||
noun • A developable surface. adjective • Suitable for development, often specifically for construction • (of a latent image) Which can be developed into a visible image. • (of a surface) Described by a moving right line, and such that consecutive positions of the generator intersect each other, allowing the surface to be developed into a plane. | ||||||||
| emulatively | 11 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| curveballed | 11 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| cloverleafs | 11 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| malevolence | 11 | 18 | nounn | |||||
noun • wishing evil to others • the quality of threatening evil | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 11 Letter Words
Words (59)
legislativeevangelicalsalvageablemalevolenceuntravelleddeliverableslaveholderlevelheadedgainesvillepolyvalenceappellativevexillariesversatilelyrevealinglyrepleviableprevalentlylovablenessdevelopablevorticellaevillanellesvillageriesviceregallyvaudevillesseveralfoldoverliteralliverleaveslivablenesslavallieresintervalleyemulativelycurveballedcloverleafsvilleinagesvertebrallyveneficallyvellicativevaricellatevalleculateunravellersmediaevallyloveliheadsliveliheadseviternallyenvassalledelevationaldivellicatedisgavelledcleveralitywell-favoredwell-advisedwell-behavedsilverplatesilver-platesilky-leavedmalevolencylevel-headedlarge-leavedcurly-leavedalleviativePhrases (32)
slave dealersilver medalpole vaulterblack weevilalto relievoyellow avensvelvet plantvanessa bellvalley feversluice valvesilver maplesignal levelservice callsatellite tvrenal pelvisrelief valvemason's levelloire valleykelvin scalehumeral veilgluteal veingalley slavefelis servalfamily leaveeven a littleedith cavelldeath valleyclarke valuecivil leadercave dwellercalves' liveralveolar bed
