11-Letter Words Containing: A,A,A,N,Y
(In Any Order)
There are 30 11 letter words,
22 11 letter phrases and
0 11 letter abbr's with
A,A,A,N,Y in.
Best Scoring 11 Letter Words With: A,A,A,N,Y
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
anaphylaxis | 11 | 26 | nounn | |||||
noun • hypersensitivity reaction to the ingestion or injection of a substance (a protein or drug) resulting from prior contact with a substance | ||||||||
anaphylaxes | 11 | 26 | nounn | |||||
noun • hypersensitivity reaction to the ingestion or injection of a substance (a protein or drug) resulting from prior contact with a substance | ||||||||
analyzation | 11 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
pachysandra | 11 | 22 | nounn | |||||
noun • any plant of the genus Pachysandra; low-growing evergreen herbs or subshrubs having dentate leaves and used as ground cover | ||||||||
pyracanthas | 11 | 21 | nounn | |||||
noun • any of various thorny shrubs of the genus Pyracantha bearing small white flowers followed by hard red or orange-red berries | ||||||||
fanatically | 11 | 19 | adverbadv | |||||
adverb • in a passionately fanatic manner | ||||||||
caravansary | 11 | 19 | nounn | |||||
noun • an inn in some eastern countries with a large courtyard that provides accommodation for caravans | ||||||||
warrantably | 11 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
charlatanry | 11 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
attractancy | 11 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 11 Letter Words
Words (30)
kinyarwandafanaticallyanalysationanaphylaxiscaravansarywarrantablysatanicallycharlatanryattractancyantenatallyanalyzationpyracanthasfantasylandanaphylaxesalcyonarianpachysandraunavailablyshamiyanahssatanophanyfantasmallyclanjamfraycaryatideanagnaticallyacronymaniaabactinallyunpalatablynyamuragirafarawaynessarkansawyerapocynaceaePhrases (22)
playing areain a broad wayhuayna capaccalendar daybryonia albaangra mainyuwearing awaywasting awayvacancy ratetammany hallramon y cajalnasal cavitynaiad familymya arenariaminamata baylynx caracalhoya carnosahang by a hairgenus mayacacanary grassanti-sway barafrican gray