10-Letter Words Containing: T,W,A,L,S
(In Any Order)
There are 108 10 letter words,
34 10 letter phrases and
0 10 letter abbr's with
T,W,A,L,S in.
Best Scoring 10 Letter Words With: T,W,A,L,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| washcloths | 10 | 21 | nounn | |||||
noun • bath linen consisting of a piece of cloth used to wash the face and body | ||||||||
| flowcharts | 10 | 21 | verb, nounv, n | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
| cowlstaffs | 10 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
| lengthways | 10 | 20 | adverb, adjectiveadv, adj | |||||
adjective • running or extending in the direction of the length of a thing adverb • in the direction of the length | ||||||||
| switchable | 10 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| walkathons | 10 | 20 | nounn | |||||
noun • A long-distance walk, either as a race or in aid of charity. | ||||||||
| watchables | 10 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| flyswatter | 10 | 19 | nounn | |||||
noun • an implement with a flat part (of mesh or plastic) and a long handle; used to kill insects | ||||||||
| wastefully | 10 | 19 | adverbadv | |||||
adverb • to a wasteful manner or to a wasteful degree | ||||||||
| metalworks | 10 | 19 | nounn | |||||
noun • factory where metal castings are produced | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (108)
wealthiestclausewitzwanderlustflyswatterwastefullymetalworkslengthwaysdelftwaresmetalwareswashclothswalkaboutswindblastswhitetailswelfaristsstalwartlystalworthsworktableswastelandsafterglowscaterwaulsswitchableflowchartstablewareswaterfallswaterfowlswaistlineswaterleafswaterlineswaitlistedwyliecoatsdeathblowsoutlawriessewabilitystairwellsbloatwaresstonewallsstarflowershallowestwhaleboatstwaybladescowlstaffscowlstavesnavelwortsswordtailsbatfowlerstailwatersmilliwattsglasswortsflatwasheswalkathonslusterwarewhitewallswavellitesworldbeatswheatlandspolywaterswatchablesscrawliestdrawplateslimewaterscartwheelswomanliestmeltwaterswhipstallssprawliestwaterglasswestwardlywhirlblasttwaddliesttwaddlingswealthlesswanrestfultwanglingsantiworldstwattlingstrialwareswaldflutesgalsworthyschwarzloteastwardlytailwheelsleastawayswreathlesswaistclothwalkshortsbasaltwarewallchartspearlwortshandtowelsswatheablepotwallerswheatmealsstrandwolfstreet-walkwallposterstreetwalkplowstaffswiesenthaltowelheadslustrewarewaghalterssteelwareswatchglasscoralwortswatchlistslaserwortsheathfowlswaistbeltsPhrases (34)
slack watermetal screwwater glassstatute lawscratch awllay waste towalt disneynewton's lawwalter hessstrand wolfwaste balersmall whitewild teaselswamp plantwatch glassscarlet hawwest bengalwidal's testsweat glandst. lawrencewhite slavestevens' lawlaw studentsweet basilfats wallerwood's metalmalt whiskylawn tenniswall socketwall streetnasal twangleast shrewdalton's lawlay witness
