Dictionary Only:
Profanity Off:

10-Letter Words Containing: S,E,Y

 (In Any Order)
There are 1,748 10 letter words, 231 10 letter phrases and 0 10 letter abbr's with S,E,Y in.

Best Scoring 10 Letter Words With: S,E,Y

Expand?WordSave?LengthUsagePointsType
exoenzymes10
31 nounn
noun

• Any enzyme, generated by a cell, that functions outside of that cell.

oxygenizes10
30
verb

• change (a compound) by increasing the proportion of the electronegative part; or change (an element or ion) from a lower to a higher positive valence: remove one or more electrons from (an atom, ion, or molecule)

• dehydrogenate with oxygen

• impregnate, combine, or supply with oxygen

rhythmizes10
30 verbv
Valid word for Scrabble US
skyjackers10
30 nounn
Valid word for Scrabble US
jayhawkers10
30 nounn
Valid word for Scrabble US
sympathize10
29 verbv
verb

• share the feelings of; understand the sentiments of

• be understanding of

• to feel or express sympathy or compassion

hydrolyzes10
29 verbv
verb

• undergo hydrolysis; decompose by reacting with water

mythicizes10
29 verbv
verb

• interpret as a myth or in terms of mythology

• make into a myth

hybridizes10
28 verbv
verb

• breed animals or plants using parents of different races and varieties

crazyweeds10
28 noun, adjectiven, adj
noun

• any of several leguminous plants of western North America causing locoism in livestock

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (1748)
absolutelyespeciallyuniversitypersonallymysteriouspreviouslystrawberrysupposedlyscreenplayhystericalbabysitterprosperityseparatelygenerositypositivelydisneylandapocalypsemayonnaiseeyewitnesshypothesispresidencypresumablyenormouslyhopelesslyreasonablyhyperspacespecialityinsecuritysympathizetestifyingdiscreetlysystematicgenerouslysensualitystereotypesleepyheaddisorderlypleasantlystationerymistakenlyexpresswayskyscraperneedlesslyunderstudycyberspacehandsomelystealthilyupholsterycarelesslypassagewaystuyvesanthelplesslydishonestyrecklesslydostoevskyeucalyptustirelesslyhieronymusgettysburgsymbolizedinsurgencyruthlesslystrychninegooseberrysyndicatedeyeglassessplendidlynarcolepsydispensarynewsworthypainlesslyostensiblysympathisegrievouslyfearlesslyprehistoryelasticitylachrymosepresbyterydiscretelydepositoryresolutelysoothsayerhypotenuseyardmasterconverselydecisivelyselflesslyflawlesslyrepositoryfreakishlysynecdocheoverstayedmastectomyinsolvencysynthesizepropensitysquirrellyperversitydistillerysheepishlypolynesianhypnotisedplayhousessymbolisedasphyxiateecchymosistastefullyfeverishlymindlesslyrestlesslyspecifyingperilouslyasymmetricshamefullybusybodiesseychellesascendancydevilishlyseismologyseamlesslyperverselyproslaverysalicylatepleasantrystringencyepididymiswordlesslylifelesslyisocyanatesystemizedtiresomelypossessoryunpriestlyconsumedlyhypertensepitilesslyfiendishlyharmlesslysynthesisedepositarymetaphysiccryogenicshypersonicreassemblytrolleybusepisiotomytunelesslyflyswatterresiliencyjoyfulnesswastefullypleasinglyyesteryearsyncopatedpolytheismpresbyopiainsolentlygruesomelydeservedlymanifestlyhypodermispersonablystridentlyyellownessminstrelsyhemoptysisdesolatelyeffusivelyunsurveyedcurtseyingspirometrypolytheistspotlesslyepiphysealepiphysialchrysoliteheedlesslyescapologyhaemolysismeasurablyhobbyhorsegorgeouslyclydesdaletypesettersensuouslyunsteadilystupefyingoppositelymyastheniaimmodestlyravenouslypreciouslylistlesslyseasonallyhesitantlydeclassifysedulouslythucydidesdespicablyspiritedlydesirouslyinsensiblydyskinesiasneeringlyspitefullymiscellanygeophysicssinisterlyepistolarylonesomelytrotskyitedesignedlysymbolizerfestoonerycovetouslyascendencyjoyousnesstuberosityincessancysphericitysynaeresislopsidedlyobservablyderisivelyaneurysmalcomposedlyoversupplyexpositoryundismayedlengthwayslyophilisepreciositysyncretisesyncretizedisyllablesynergeticinsistencyinsobrietyepiscopacyprecursorysomatotypedetestablysaprophyteviscometrycrystalizesynthesistbaptisterypensionarypanegyristresolidifyphenocrystholidayerscubbyholesunderplaystympanitescyclostomepyrolusitethievishlysandpaperyratepayersclepsydrasmovelesslygraywackessymboliseshypothesesxylophonespolypariesdecorouslyabsorbencymonolayersandrogynessymbolizesabrasivelykeypunchesexiguouslyplasmolyzeassertedlydelusivelyhydrolytescatalyzershoneymoonskeystrokedaversivelyobeisantlysonglesslydehydrateshydrolyzescheapishlydyskineticrhymestershypnotizesphenotypesesurientlyreanalysesreanalysisunsayablesreanalyzesheteronymsdisquietlypelycosaurdialysatesadipocytesbootlesslyabstruselyportrayersgynarchiessympathiespressinglycocksurelyexocytosedexocytosisdyspepsiesreclassifyspeciouslydialyzatesflyweightspresumedlyresiduallycoryphaeuspartygoershypocritesrhytidomesprototypespresurgerysynergismspanegyricsrepaymentsrestudyingredisplaysoxyuriasesaccursedlygynophoresmisemploysrehydratessubacutelysportivelyhalophytesosteocytessuretyshipskylarkerscyanotypessluicewaysamnestyingnebulouslyprepenselybioassayedbryologiesskylightedayurvedicsdefensiblyhydropsiesbryophytessneakinglymicropylesunderstoryholystonescarryoversglycerideshybridizesformlesslycybercastssubjacencyhairstylesshrievaltypolyestersskyrocketscybernatesdisplayersskeletallysocietallymicrocytestypestylesaerophytesconfusedlybyssinosessystemizesjackasseryambrotypesbystandersmycologiesmyeloblastjourneyersmythicizespristinelyecosystemsmycophileswindlesslyglycolyseshydrangeasscenicallynamelesslypyroceramsclaystonesvoyeurismslaypersonsdisarrayedaccessiblyleiomyomasresponsoryviewlesslymythmakerscanyoneershorseplayshyperbolesboycottersembaymentsallotypiesresprayingroysteringsweepinglysanguinelyresurveyedurinalysesmyelitidescholecystsfootlesslysemiyearlyjoyfullestlinotyperssynopsizedsyllabizessynopsizespostsyncedtypologiesappositelypyrolysatesubsystemssynostosesselenologyplatypusesparaphysesacetylenespachydermsyoungstersenjoymentsdensifyingmesenchymeallusivelysubtenancymanslayersnebulositygladsomelyecchymosesproenzymesreservedlysoullesslysyllogizestyrannisedjellybeanssuperheavytigerishlytyranniseseuthyroidsdrysaltershyphenatestyrannizesfreestylestoilsomelydisobeyersgymnospermdisobeyingplayfieldsenthymemesannoyancesproselytedhypostomesproselytessynthetasestylebooksferryboatssyntheticsprespecifygraybeardshyphenlessserigraphycrayfishesplaymakerscopolymersisoenzymesisoenzymicresignedlymonogyniessweetishlymesophyticcollotypescyclostylekeybuttonstransiencygreyhoundsgraynessescyclonitesnurserymandestroyersthymidinesendostylesdestroyingsyncretistexcusatoryclepsydraecostlesslycrazyweedsserotypingmisogyniesgreynessescrescivelysymmetrizeeuonymusesclerestorywyandottesgraywatersxylophagesathrocyteshydrolasesthymocyteszygositieshoneycombspericyclessemidryingmoneywortspaymastershaplotypesbuoyanciesmartyrizesstylobatesvenomouslyboyishnessshinneyingmyopathieszygosporesdidynamiesnaugahydesnematocystwyliecoatsflybridgesgigacyclesytterbiumspolyamidesxylotomiespolyaminesresonantlystereologyhydrolysesstylolitessuperiorlyinterplaysyellowlegsencystmentanhydridesremissiblysyndesisesadhesivelypoppyheadssewabilitytypescriptanhydriteshyperlinksspyglassesdoohickeysdysentericthyroxinespolymerasefearsomelymyositisesemissivityentophytesspymastersdivisivelydysgeneseskeystrokesdiseconomyryegrassesmyosotisespolymerisepermalloyspolyphonessyphilisescockneyishcockneyismzymologiespyorrhoeasnauseouslyobsoletelydyslecticsbreezewayslongsomelysurveyingssyndicatesamplidynesjonnycakespresbyopeshemicyclesleukocytessymmetrieszymometersflyroddershypoxemiaspsephologyoxycodonescyanamidesmethylasesoxygenasesperigyniesperigynousgynandriesmethylatesoxygenatesnurserymenflyspeckedastrocytesdoomsayersparalyzerssuperlyingpolychetesantonymiesphenylenesdoomsdayerpresbytersmethylenesdiaphysealtwaybladesabeyanciescorybantesmesophyllspolypodiessecludedlymesophytesexocytosesautophytesstereotypyneodymiumsoxygenizespelecypodsdayflowerssugarberrysynecologyphenytoinsdyspepsiasoxygenlessgesturallyhyperopiassubsocietyperilymphshologyniescohesivelyastrometrygyniatriesbisexuallyskybridgesstericallysporophytedyspepticsrhythmizespyranosidephototypesyeastinesscoenocytessufferablysympatriesmyrmidonesincisivelycymbaleersmelaphyresbotrytisesbayberriessubvarietyexoenzymescryogeniestonelesslyxenocrystsperimysiumcherimoyasspinsterlysymphoniesascomyceteapoenzymescaconymiesholophytessensuositydisemploysslatternlyhypsometergovernessyhypodermascryometersmetonymiesmonkeypodsyuppiedomspyrethrinssterlinglysupernallyinsecurelyhysteresesseminuditymonkeypotssymphysealpolysemiesgynophobescounterspysynergistspyrethrumshysteretickilocyclessemiweeklytachylitesgeyseritesskyjackershyperpneastachylytespresurveyscryophytesswaybackedmystagoguedayworkershysteresishistolyseslawyeringsmyasthenicheliotypesfecklesslysentientlytimelesslyyohimbineseucaryotesjayhawkerscyanuratescymophanescryoprobesmysticetesjaywalkersasexualitysolvolysesmegacyclescryoscopeshemizygousholystonedrescissorydysgenesisoysteringspolysemousmystifiershypallagessphygmusescybercafeshistiocytewavelesslyyellowfinsmosquitoeyglycerinesmolybdateshypogynieshydathodeseurythmicslovelesslyhydroserescybernautsmetastablysyncretismunchastelypolygamiestypewritespolyteniesdysphemismskysurfersasymptoteserysipelasjunglegymssystemlessmacrocytesmeromyosindasymeterspsilophytezettabytescotyledonspolythenespennywortshydrospacecyberpornssynaeresessegmentarycyberpunkstyphlosolehemolymphsstableboysskywriterscybersexesasyndetonshomonymiessheepberryessayisticpropylenespersonaltyskywritteneyebrightshemolysinssynagoguesladyfishesapophysealphonotypespropylitessynalephassynaloephanonsystemslogotypieseyednessesbusynessesphotolyseshyperbolascysteamineeurythermsglycosideslectotypeshemoptysesbreakawaysarytenoidslysimeterssynonymieseurythmieslysimetriccycadeoidssprynessesphotolyzespolywatersboyfriendsyeomanriesautotypieshyponymiesendolymphspresbyopiccysticerciepicalyceserythrismsphrensyingpolygoniesmetaxylemssubpotencyepicalyxesepiphytismerythritespityriasesgamesomelybodycheckslysogeniesstenotypedmisassayedstrongylessynonymizecyclamatesxerophyteshydrazideslysogeniseplanlesslyhydrazinesstenotypesosteopathycornerwaysmonocyclesporphyriesamebocyteshydroxideskerseymeremonorhymesnewsweeklynonplayerslysogenizegyroplanescellarwayskindlesslysuspensorymyelocytesgyroscopeshypophysespyrologiesseasonablyspeciositysyllabizedbodysurfedexercyclesviperouslybodysurferhypertextslaryngealscystitidesnymphetteseyeopenerspolygyniesyottabytesmyelogramscausewayedbellyachesguayaberasreversiblysteelyardssuppletorybellybandssemeiologycystocelesspeleologyeyepoppersjoypoppersarchetypeserythrosinacetylatesreadymadeskaryosomesshrewishlysyllabusessecularityradiolyseshydroceleskaryotypessubeconomyendophytesviscerallyhousewifeycystoscopemisrelyingoversimplyyesterdaysmayflowerspresidiarypyrolyzersstepfamilypennycresssyncarpiesuppitynesspachyteneschrysotileeyestrainspolyimidesyesterevesberylliumseyestringsclearstorygraveyardsmayoressesdynametersescalatoryhypercubeshypostasescopaymentssuperalloysyllogizedpolylysineyourselvestoponymiesanchylosedawaynessesanchylosespyrometerssatyriasesspectrallymyxamoebasnumerouslyeukaryotesillusivelypresignifyhokypokiescyclizinesstrathspeyversifyingsardonyxeshyperemiasdynamitersearlywoodssociometryfreestylercityscapesmyxoedemasdrysalteryjellyrollslifestylesdictyosomesperryliteminelayersepisomallyunderclaysphylaxisesferrotypesperistylesphylesisespterygiumsseismicitysuzeraintysylvanitespseudonymscaryatidestinkertoyspterygoidsemphysemasoutjockeyspargylinesphyllariespolymerismantistylescytogeniesemphysemicpyelitisespyelogramshygienistsnonlawyersspecularlycytologiesecdysiastssemicolonyphagocyteshighflyershypostylestactlesslythylacinesheterocystraygrassessylvinitesmeasuredlyautolysategoldeneyeseriophyidsevonymusesgrayfishesroundelaysleucocytesshaggymanetyrosinasegainsayersmistrystedsuperhypedmesomorphysuperhypessyncopatesbuckytubessynthetistgamynessessomnolencysymbolisermesophyronxyloidinessclerotomycytopeniassyringefuldaisywheelsynthetizewestwardlyxylologiesgreybeardssyrrhapteshypericumsquaestuarydyophysitechemitypesdolesomelytolypeutesperomyscushypnoidiseobservancypropenselypygostylestewkesburywykehamistxylometerssevenpennyhexastylescagynessesspreagheryalbespynesgreylistedzygophytesdisk-jockeymartyrisedheleodytesmyomanciespentastylemartyrisesdyothelismmenyantheskeyloggerssymmetriseedaciouslychromakeysgnoseologyshellycoatsidereallysquint-eyedgreystoneslaryngitessilver-graystaphylinemooseyardssilver-greydisamenitygreywackeszygospermsresolvedlypaynimrieszygosphenepaederastysyntonisedplasmolysesyntonisespyknosomesquiescencyjollyheadsmyophiliesytterbiteschemonastyscolytidaephysalisescensurablyseventy-onestaymakersspiny-edgedstegomyiassyntonizedhydrolysedcatalyserssyntonizeshydrolyserseventy-sixuranalysessynderesesseventy-twospeedfullysynderesispercursorydieciouslyanhydrasescomatoselyoverrashlycatholytesstylometrydyscrasiteampholytessarcostyledispurveysstylophoneanalysablerybaudryesscaldberrypyogenesescordylinesvitreositypyogenesiskeystoningstickybeakstylopisedsyndeticalsypheringsunsisterlyhypnotisesstylopisesoverstayervitreouslybradyseismklondykersgastrocybehoneybellsswellinglymesognathystylopizedsubsidencysurveyablegynaeceumsscheminglystylopizessyphilisedeximiouslypolybasiteprozymiteshoneytrapsseducinglydasyatidaedecrassifysymphonisesurveyanceenneastylefasciatelyhypermartshoydenismsisohyetalsscythelikefoetoscopysymphonizehydrobatesprincesslystarchedlyhylophytessilentiarysystemisersymmetrianhylotheismsyphilizedsystemizernecroscopysyphilizesflypitchesreanalysedhylotheiststony-brokepsychiatersnakeberrystellatelyhackneyismhalloysitestealinglyparalyserssneakishlytetrastyleparleyvoosbusybodieduseabilitydasyuridaetaillesslysexagenarybluish-greyflyscreenstycoonatescalystegiagarryowenssouthernlystereotomydialysableanonymisedslaughterydaycentressueabilityforesayinganonymisesintrorselyfairytalesparablepsychylaceousplasmacytemoygashelstreatylessoxygenisedspherocyteoxygeniserflystrikesanonymizesmyrioscopeoxygenisesmetacyesispentylenespolychrestantrorselypresbytismhypernovasstarry-eyedpowerplaysdacrymycesrhythmisedoyster-fishdyer's-broominpaymentsrhythmisesmelanositydyspathiesvesicatoryharassedlytoyishnesslophodyteshypsophobesoberinglyfibrocytescorylopsesacatalepsyhyperosmialithophyseseminalitysecond-yearunanalysedaplysiidaeunbiasedlyoysterfishhyalinisedzizyphuseshyalinisesrhythmlessdysphagiesbaby-sitteriridocyteskyphosidaesyneidesespadymelonslucklesslysyneidesistricyclerscynopterusizvestiyascryocablespersuasoryhyalinizessymphilieszelotypiasgeothlypispyreneitesrhythmuseseastwardlyhornyheadssphyrnidaedebasinglyhypozeuxisderisorilyleastawaysslipperilysporocyteshypericismhypsiglenacoryphenesmyrtaceousstreetboysmonkeyismssynergiseddryopterishypsometrysynergisesunswayableflexuouslyphoneynesscanyonsidehairdryershyalonemasdecastylespanegyriesspeakinglycymiferousoverwiselypanegyriseflunkeyishprayerlessprocrypsessynergizedflunkeyismsynergizeshysterickystrainedlyhysteritisseptectomypoetasterygynostemiaregistraryspiceberrynycticebuslathyrusesunsymmetrypolysomiesrecyclateshybridisedgenyonemusamylaceoustridymiteshybridiseroctastylesanswerablyxenoglossybaryspherecaprylatesareostyleshybridisesseemlyhedsdysthesiashypogaeoussquamoselyglycaemiasisopachyterecycliststourneyersbawdyhousebiosurgeryhypalgesiafifty-sevenstylomecontimenoguyspolysemantoverswayedtypecastermycosterolbreaksawayhypalgesicspellinglysyngeneseshypogenoussyngenesistachypneasunusefullysteatopygasubdeanerydiophysitesyngeneticparonymiescarrytalesnewsagencyengyscopesamylolysesnosy-parkercurly-headshydroscopesunken-eyedmythicisedsystemisedconsectarymythiciserfishwifelyyammeringshedyphanessystemisesbathyergusyellowiestbathylitesbesottedlybyssaceousseethinglymythiciseszygnemalesdisfluencystrokeplaysubjectifytrioxygensulcerouslylyre-shapedpennylandsphenacomyscoyishnessbathyscapepolygamisemolybdosesdesolatoryeucryphiasmetaphysisclayeynesshyperrealsbisymmetryfeateouslybaselesslyinerasablyjockeyismsmeronymiesdasypaedalsyndetikontyphaceousasynarteteherrymentshydraemiasinerasiblysynoeceteshydrosomesjockeyshiplow-densitykryometersmatsyendrapredestinyresinouslybytowniteschessyliteself-styledsynoecisedhomebuyersstedfastlyaeschyleansynoecisesessayettescelioscopypygoscelisdiffusedlysynoecismsunsensiblynecrolysisasynergiasenhydritespolygeniesasynergieshemolysingsynoecizedpolygenismkeelyvinessynoecizesreversedlyjouysaunceenhydrosespolygenisthaemocytesquestinglydextrouslyscavengeryabsorbedlynyctalopesozonolysespolygenoussuperphyladytiscidaeburleycuesseparatorycopytakerssynoeketesphotolysedapophysateretrorselylysergideshydrotaxesjovysauncehydrastineresistiblyoctostyleseudialytescessionarysciophyteslysigenousdiapyeticscystectomyhaemolysestalbotypessilvereyessynonymiseerythrinaspyocyanasemetrostylehesitatoryroystererschalybitessematologyosteolysisroysteroussynanthiespausefullyvixenishlyperistylareyeleteersfadelesslyarraymentspyrolatersstenotyperhypertonusdickey-seattayberriespheasantrysynoecioustemerouslymegaphyllsstenotypicsynapheiasreasonedlycystideansosteophytehydrovanesleisurablymyelitisessyllabisednymphaeumsgainlesslysyllabisessynopsisedalectryonsbodyshellssynopsiseshypophygesmetecdysescystinosesprotensityrevestiarymetecdysisviperishlybaldmoneysautocyclesazygosporedisc-jockeyrock-steadyecstasyinghastefullycruisewayssynaptasescystitisesmythomaneshyemoschusbobbysoxerassurgencyhercyniteskaryolysesdisposedlyperviouslyproteolyseleylandiisdigestedlyhematocystabstinencypyrolysersdigestiblyserjeantrysynarchiesassythmenteyeshadowsgyrovaguesstoryettesdrayhorsesperishablyhypopnoeasmassymoresstorylinestachypleustryingnessreaedifyesrosy-purplehay-scentedsynastriesacetylidessyllogisedsleepy-eyedcoryanthesspoylefullspulyieingsyllogisesyesterevenguberniyashelophyteshexagynoussucculencydictyogensmythopoetsunshakenlycondenserydahabiyehsproembryossiderocytedensimetryecchymosedtrendyismsneurolysinyestermornracemoselyburramysesprettyismshieroscopyhypnotiserexpansiblyracemouslypresent-daysyllogiserfeverouslypolylemmasnumerositycrystaliseinvasivelybountyhedsmiscreancysupplymentceylanitesspray-driedblastocytefarinoselyone-sidedlypseudologyceylonitessatyresquestrickenlysyntenosesmylonitisesyntenosismalaclemyssatyressessyllogizersepticallyhaemolysinsyntereseslawyerbushtyrannisersumerologysynteresishygroscopesylphidineallaymentssyntexisessaucer-eyedectophytespararhymesplaybussesbridlewayshomotypieslifestylerdiphysitesyouthheadsisocyanideforty-sevendessyatineenvoyshipspycnosporemistraynedpycnostylebrachyaxesforsakenlypolymeriespterygialssixty-eightgoose-tansysynthetismarchitypeskallitypespyrophoneshyphenisedhyphenisesdecagynoussylvestralcalypterashylocereusparhypatesprehensoryhyphenismshypostressrocksteadysixty-sevenstercorarymistresslyproselyticpteryloseshurtlesslystridewaysimpulse-buypterylosiseuphrosynesixty-threepolymerousxylogenoushomostyledtriptyquespyrogenoushygrodeikshyphenizesnephthytisrealisablyichthyosespeerlesslyyatteringsneurolysesphyllodiesliterositymesitylenesynthetiseneurolysiswayzgoosesaraeostylecytometersaeolipylesagonisedlypokerishlystannotypeplaylistedpyroscopesguessinglyzincolysesjolleyingsklendusity
Phrases (231)
yves tanguygenus lygusfleur-de-lysepoxy resinbrya ebenusbrandy noseroot systemmoshe dayanfield pansygenus khayagenus cycaslead astrayvery softlyjohn wesleyunix systemheavy swellsmart moneyisle of skyetone systemwendy housecase-by-casegenus physalist systemexpress joyeaster lilyhenry jamessean o'caseyhouse partycrossed eyebeauty spotcurry saucesubway faremaster copytake it easyleo tolstoynorse deitybobby jonesmaple syrupbasil thymejames joycegenus caryapenny grassempty wordsdesert lynxlawyer bushgenus typhajumper staysafety islesafety locksidney webblay waste toby all meansstep-by-stephelen hayeswalt disneyin a pig's eyestay-at-homeholy personsystem callsilver citysea lampreysnowy egretsnowy heronwillie maysbessy cercasteady downhoney crispsour cherrytin pyritesseed oysterdragon's eyeoxygen maskwhite daisyos hyoideumdry measureemery stoneprivy pursecow parsleyyemeni filsperry masonbaby bustercanary seedruby spinelvery pistolwelsh poppyvena azygosyerba mansayerba santaoyster bankpine sawyersentry dutygenus bryumchinese yamalloy steeloyster crabmemory lossturkey stewsea trifolyoyster parkalkyd resinbaby's tearsoyster stewschool yeargenus xyrisdata systemgenus yuccacownose raygenus nyssasibley tentgenus ptyassunday bestkeyhole sawenglish ivyfalse calyxallyl resinstyle sheetjersey cityjersey fernjersey pinecrazy horsemass energymother's boycrazy housegenus layiamother's dayrose familyst. gregory icasey jonesrest energyyeast doughpayne's graygenus pyruscelery saltpayne's greycelery seedjury systemcoyote bushenglish yewfat tuesdayeye diseasesurvey milelady's lacesstroke playyellow basseye surgerytoy soldierlens systemcandy storefancy dresstoy spanielthe holy seebeauty bushpygmy mousesquare awaysupply linecounty seatbeauty shopwei dynastyduc de sullyside by sideswedish ryeshoofly piegenus oryzafather's daykhyber passbigeye scadhenry sweetdaisy wheelyellow irisspotted raycystic veinsquare yardfuel systemmerry bellsdowny chessfunny housekrebs cyclesell-by datesand cherryhershey bargenus hydraroyal housepeyton rousnews agencysleepy dickpenny stockeasy streetfile systemsand myrtlecave myotisice crystalbush lawyerparsley hawsum of moneycheese traycrystal setcrystal teatrophy casewhiskey jugsafety archblue sky lawsafety beltwhisky neatyellow spothessian flysafety bikegenus dryasday nurserysafety boltazygos veinrye whiskeyfiscal yearsafety fusebushy asteroxeye daisypatty shellsea chanteysafety lampjames wyattwestern yewspinel rubysyrian bearharvest flysoybean oillay witnesssafety railsurety bondsafety zonevinyl resingenus mysisasa yoelson
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen