Dictionary Only:
Profanity Off:

10-Letter Words Containing: N,G,A,H

 (In Any Order)
There are 567 10 letter words, 123 10 letter phrases and 0 10 letter abbr's with N,G,A,H in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
whizzbangs10
37 nounn
noun

• a small high-velocity shell; it makes a whizzing sound followed by a bang when it hits

• a firecracker that (like the whizbang shell) makes a whizzing sound followed by a loud explosion

humanizing10
25 verb, adjectivev, adj
verb

• make more humane

highwayman10
25 nounn
noun

• a holdup man who stops a vehicle and steals from it

highwaymen10
25 nounn
noun

• a holdup man who stops a vehicle and steals from it

mythmaking10
25 verb, nounv, n
Valid word for Scrabble US
hebraizing10
25 verb, nounv, n
Valid word for Scrabble US
hepatizing10
25 verb, adjectivev, adj
Valid word for Scrabble US
archaizing10
25 verb, adjectivev, adj
verb

• give an archaic appearance of character to

aphorizing10
25 verbv
verb

• speak or write in aphorisms

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (567)
washingtonchatteringstraightenrehearsingchallengedscratchingcopenhagenexhaustinggrandchildenglishmanshatteringchallengerenchantingexchangingbirminghamhesitatingpurchasingcunninghamharvestingsunbathingbangladeshgramophonewavelengthheadstrongnightstandhighlanderphonographchangeablescathinglychannelingwainwrightcharminglyheadliningunchanginghighhandedrecharginghumanizingtheologiangarishnessnightshadechangelinghandspringshampooinghearteningshenaniganbarhoppingagapanthuswholegrainchangelessshanghaiedgonorrhoeachastisinghighwaymannaughtiestweatheringphalangealpharyngealsubheadingsmashinglyhypnagogichauntinglyfeatheringbellinghamlaughinglypathogenicsinghalesepantagraphprognathicharanguingcrashinglynephralgiapantographmarshalinganglophilerockinghamchangeoverfashioninghomemakingatrophyingshoemakingrephrasinghemangiomaanglophonechampignonchasteningheadspringgauchenesslengthwaysanglerfishanaglyphicvinegarishtarnishinganguishinggarnishersgarnishingearthlingsvenographygatheringsmisshapinghighwaymenhappeningsshowcasingchagriningchagrinnedethylatinghebetatingonslaughtsvarnishingchinwaggedshogunatesslatheringadhibitingblatheringreteachinggalumphingevanishinghacksawinginswathinggynarchiesharanguersbushrangerharbingershalogenateenswathingrepatchingshearlingscharteringenchainingingatheredunswathingharbouringsheathingsunchaininguncharmingharumphingasphaltingchallengeshydrangeasdraughtingunlatchingshrinkagesmythmakingplanishingmegaphonesmegaphonicouthearingstraphangsanchorageshardwiringhomogenategazehoundsabolishinghankeringslanguisheschamferingbackhoeingnighthawkshatchelinginhabitingstomachingchamoisinghabergeonshatchlingschargehandsharpeninggearchangehusbandinggrayhoundsratchetingshinguardsstaghoundsgarnisheedholidayingnomographsgarnisheesnomographylonghairedescheatingplaythingschariotingchafferinglongheadedoverhatingringhalsesphalangersphanerogamsonographymahoganiesnaugahydestallyhoingthatchingssiphonagesslashinglychangeablyorphanageshormogoniarehandlingcheapeninghobnailingimpeachinganemographmishearingdragonheadstringhaltshavelingsalongshorelightplanerehearingscohabitinghebraizinghepatizingcharmingerhackneyingbethankingtragacanthharnessingcashieringlanguisherprewashingshallowingherniatingharpooningclaughtingcheongsamsinearthingantigrowthshandygaffscraichingspringheadheptagonalscraighingshanghaiercarhoppingcohobatinghalogenoushalogetonsrenographyalightmentharsheningchalcogensleatheringdebauchingunchairingwharfingerhairspringsulphatinguphoardingbechalkinghandselinggreenheadsbechancingunchargingphonogramsgreenheartbecharminghardeningsfraughtingboxhaulingchronogrampharyngalskeelhalingphreakingshearkeningputonghuasunearthingthrashingscarragheenarchaisingsaganashesunteachingarchaizingarchangelsrematchingarchegoniarechangingwhizzbangsmegaphonedpreshapingchapteringpathogenesbunchgrassrechartingchamberingunleashingexchangersschmearingshikarringhumanisingtrauchlingchivariinglanguishednightfallscochairinggonorrhealgonorrheashosannaingnightmareslaughlinesnephogramshansellingwampishingcraunchingkurbashinghopsackingpreheatingorthogonaloutshaminghoarseningchampagnesstagehandscathectingchampaignsgreenshankwhipsawingwingchairsaphorisinggranolithsphagedenasgranophyreshagginessaphorizinghamstringsupreachingbreathingsshaggymanestaunchingindraughtsmonographsmonographyunhoardingathetizingdraghoundsgunmanshipphagomaniahushabyinggynophobiashagreenedhallallingexhumatingchicaningshaubergeonxylophaganlengthsmanhandbaggedhagerstownspreathingphalangidschaffinglygrassfinchupflashingsplashingsshort-rangeforhailingsphagnalesanhungeredsnatchingsshauchlingsplatchingrhubarbingepitaphingashlaringsanhingidaesiphonogammishappingdisgarnishthingmabobthingmajigashleringshepatisinginhumatingmesognathygosainthansphenogramgosan-chikugenethliachebraisinghigh-handedjagannathaappeachingcacholongsbraunchingcheatinglyrh-negativephansigarsreheatingsloathinglystealthinghigh-octanezoophagansmachinegunhatemongerclauchtingdining-hallrecatchingcasingheadthunbergiasphingidaeallnightermachiningsharassingsvanishingsspringhaasthereamongabhorringsspringhalthandlangerspringhaseinchoatingqinghaosushalogenoidchantinglyhexangularhypsiglenashamblingsharrowingsbleachingsalcheringanarghiliessonographsingathererupheapingshugueniniaenchargingninkharsagauthigenicninkhursaggramophonyencharmingscranchinggashlinessflaughtingauthoringsflaunchingdishablingcliffhangsfearnaughtgreenhandsfearnoughtcynghaneddgleicheniathraipingsmoehringiaaffrightenshoegazingspanghewedgenophobiathingamiespantophagylong-hairedthrapplingpreachingsbinghamtonlong-headedchallaningenhearsingangashoresfatheringschiliagonsangiopathyorchardingangelhoodsplanigraphdraughtmanungathereddraughtmennecrophagyunhappyingbellhangerhijackingsbranchingsgnaphaliummuskhogeansyngnathusnothofaguschittagongstanchingsscrauchinghaymakingsscraughinggraunchershegemonialheartlingslagerphonegraunchinghomorganictithingmantanghininsunhattingsgnetophytaearbashingflanchingsguarishingnightclassrecheatingknightagespathognomyondographsgianthoodsknightheadunfraughtsbarasinghahygienicalhypnagogueempeachingatchievinggiantshipsnightgearsunhearsingmethanogenhexagynianhexagynouspergunnahshendecagonunheartingupcatchinghammeringsring-shapedshotmakingnegroheadsaphetisingnosographyaphetizingnephographpentagraphroneographbeheadingsgnashinglychiackingsanglophobephaenogamsnephralgicphaenologygymnorhinastenographhalf-lengththwackingslightermananglophilsheadbangedmeshugasenphagedaenageocachingshadowingsthwartingswing-shapedrangershipnightwearsangophorasphagedeniczygobranchinhaustingzincographhusbandageerignathustanglebushoverhalingphalangidaorange-huedphalangistinhearsingclashinglychangjiangharmdoingsphalangiumathetisingploughlandschappeing
Phrases (123)
sponge bathwhizz alongsun bathinggenus khayagenus aphisright brainwagon wheelhang aroundpigeon hawkhanging flybangla deshhorse graingenus physahuman beinganchor ringbirth pangsbridge handcane blighthearing aidgenus hostagenus avahichange formnight watchnautch girlgenus typhachange overhigh germantangle withtaking holdgrass finchjohn mcgrawpanel lighthigh seasonbean blightget the hangmachine gunhoney glandnegro peachngaio marshgun chamberwhaling gunheating oilheating padstrap hingechain tongsgenus chararight alongright anglegarden hoselymph glandhelix anglehog snapperwatch nighttowing pathgenus hakeahonor guardgenus phocahang gliderhognose batphase anglegrand duchygenus ochnaghost dancehiring hallham and eggsking arthurenglish oakhouse agentgrand theftangel sharkbathing capgenus thujabathing tubhigher rankarm's lengthshove alongcharge unitbathtub ginhans c. j. gramgiant conchhouse organhans geigergenus heveagiant hiveshuman rightgiant perchhearing dognag hammadimouth organwishing capharpoon gunholland ginharpoon logbunch grasszhuang zhoulethal genegenus hoveaangler fishdeath angelhalf gainercoat hangeryouth-on-agegenus hydranight latchshingle oaknight ravenchang jianggang ploughgive thanksnight snakehaying timehigh and lowbeach wagongenus cathachuck wagonsea bathingtouch-and-goganoid fishheat energyheat engineherb gardenchina grasswashing day
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen