10-Letter Words Containing: M,I,K,H
(In Any Order)
There are 58 10 letter words,
8 10 letter phrases and
0 10 letter abbr's with
M,I,K,H in.
Best Scoring 10 Letter Words With: M,I,K,H
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
mythmaking | 10 | 25 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
hummocking | 10 | 24 | nounn | |||||
Valid word for Scrabble US
| ||||||||
lymphokine | 10 | 24 | nounn | |||||
noun • a cytokine secreted by helper T cells in response to stimulation by antigens and that acts on other cells of the immune system (as by activating macrophages) | ||||||||
blacksmith | 10 | 23 | nounn | |||||
noun • a smith who forges and shapes iron with a hammer and anvil | ||||||||
matchstick | 10 | 23 | nounn | |||||
noun • a short thin stick of wood used in making matches | ||||||||
makeweight | 10 | 23 | nounn | |||||
noun • anything added to fill out a whole • a weight added to the scale to reach a required weight | ||||||||
bumpkinish | 10 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
shadkhanim | 10 | 23 | nounn | |||||
noun • (Jewish) marriage broker, matchmaker | ||||||||
milkshakes | 10 | 23 | nounn | |||||
noun • frothy drink of milk and flavoring and sometimes fruit or ice cream | ||||||||
sheikhdoms | 10 | 23 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 10 Letter Words
Words (58)
blacksmithmatchstickmackintoshshirtmakerkhitmutgarmotherlikerockinghamhomemakingreichsmarkshoemakingmakeweightskirmishedskirmishesbumpkinishmythmakingshadkhanimmilkshakesmakeshiftsmahlstickschemokinesbirthmarkshummockinglymphokinemonkfishesshrimplikehelmetlikeskirmishersheikhdomsmilkfisheslocksmithsklephtismsunhomelikewykehamistmethinkethskrimshankmock-heroicchain-smokehackneyismscrimshankchurnmilkskhidmutgarthumbikinskitchendommetchnikovhaymakingskrishnaismjacksmithsmatrioshkahumankindsmatrioshkishotmakingphenakismsjokesmithssmoketightmatryoshkiclocksmithmakunouchichemickingPhrases (8)
shrink fromstrike homekra isthmusmalt whiskypumpkin ashwhisk broomquick marchminke whale