Dictionary Only:
Profanity Off:

10-Letter Words Containing: L,S,A,R

 (In Any Order)
There are 2,582 10 letter words, 313 10 letter phrases and 0 10 letter abbr's with L,S,A,R in.

Best Scoring 10 Letter Words With: L,S,A,R

Expand?WordSave?LengthUsagePointsType
equalizers10
28 nounn
noun

• electronic equipment that reduces frequency distortion

• a weight that balances another weight

• a score that makes the match even

jaywalkers10
27 nounn
noun

• a reckless pedestrian who crosses a street illegally

schmalzier10
26
Valid word for Scrabble US
xylographs10
26 nounn
noun

• An engraving in wood or woodcut, especially one used in printing predating the Western tradition (14th c.).

• A print taken from such an engraving.

squarishly10
25 adverbadv
Valid word for Scrabble US
paroxysmal10
24 adjectiveadj
adjective

• accompanied by or of the nature of paroxysms

crystalize10
24 verbv
verb

• make free from confusion or ambiguity; make clear

• cause to form crystals or assume crystalline form

• assume crystalline form; become crystallized

• cause to take on a definite and clear shape

catalyzers10
24 nounn
noun

• That which catalyzes.

• A catalytic converter.

formalizes10
24 verbv
verb

• make formal or official

• declare or make legally valid

bilharzias10
24 nounn
noun

• an infestation with or a resulting infection caused by a parasite of the genus Schistosoma; common in the tropics and Far East; symptoms depend on the part of the body infected

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (2582)
personallyreasonablejournalisthistoricalindustrialregardlessleadershipscreenplayhystericaltransplantmarvellousaustraliantranslatorseparatelyjournalismsolidaritybinocularsmiraculouspresumablyultrasoundstructuralbreathlessastrologermarseillesreasonablyversaillescharlestonsilverwarestranglingsimilarityorchestralhydraulicsisraelitesschoolyarddealershipsplatteredstalingradillustrategraciouslysutherlandsurgicallynaturalistcarelesslycornflakesevergladesbratislavasomersaultplagiarismstricklandsurrealismsurrealisttesticularimpersonalchivalrousaltruisticsalamanderblasphemerfatherlessnarcolepsyadulterousanswerableliberalismdreadlocksreassembleforecastlefearlesslyfiberglassstabilizerneutraliselachrymosemilitarismadulteressdisclaimerlegislatorwholesalerlancashirehandlebarsgreaseballstimulatormilitariesmeasurablelandscapersingularlypersonablecornwallisultrasonicfreakishlylebensraumsemiformalbordelaisehorselaughslanderousspeculatordissimilarsunderlandlaryngitiswanderlustpleasuringplasteringvalparaisoheraclituslacklustercagliostroluminariesmalodoroustattersallmoralisticstraightlystreamlinefibreglassparalysingbalderdashsilverbackscripturalurinalysisperishabledrosophilamasterlessleaderlesssalubriousglamourousstabiliserescadrillestepladderrelativismabstractlyprotoplasmoscillatorradicalismslipstreamplesiosaurnaturalismelasmosaurproslaverypleasantrypectoralispersiflageranunculusperiostealsubsternalparoxysmaldemoralisefilariasisrevitaliseunreleasedschoolmarmsenatorialharmlesslyserializedtelecasterflatterieslemongrassobservableausterlitzfederalismsculpturalreassemblystragglingsimulacrumtransexualflyswatterparentlessabsorbablelanguorousmilitariststreetlampspirallingunscramblemetatarsalcaballerossecularismliteralistramshacklepersonablyneutralistcensorablelacklustreespadrillerestorablescreenlandtransferaltranslunaralgorismicstealthiersubnaturalmetalworksplagiaristreleasablefibroblaststrelitziacrashinglysuborbitalsecularistisothermalorthoclasetemporalismeasurablymarbleisedcollarlesssertralinebrutalisedcrawlspacealexandersrelativistravenouslybelorussiaalzheimersflavorlessunderclassmarshalingsaltshakerbelarusianbalustradeultrasuedesacroiliacsurvivablemegalosaurfrugalnesssubnuclearmoralisingformalisedvestibulartrivialisemannerlessfederalistpopularisemarshalledsaturnaliaepistolarysalvadoransufferablespringtailsphaleriteallosaurusspheroidalsacerdotalobservablyaneurysmalsurplusagemilitarisesynchronalformalnesspresumablevalorouslyclangorousascribableunsalariedgeneraliststeelmakersupplanterdisulfiramsepulchralcreaselessaerosolizepaltrinessankylosaurallegorisenaturalisemensurableflavorsomeanglerfishsecularizecradlesongcrystalizesemestrialcranesbillcensurablesanderlingalmsgiversholidayerscamarillasdelftwaresunderplaysprereleaselampoonerslegalizersspreadablefabulatorsgearwheelsglamorizesintervalesrelishableresettablecalibratesarchrivalssarcolemmaluxuriatesvenerablessalometersearthlingsbarcarolesdisprovalsevaluatorsclepsydrastarpaulinsreplicatescabrioletsjournalesetitulariesrereleasedjailbreakssarcoplasmstipulatoropercularsrazorbillslavalieresgranuloseselutriatespolypariesrealnessesinsulatorspercolatesbracteoleslatecomersmaladroitsdaredevilsalacritousmonolayersfortalicespolarisingcaravellesmolaritiesabrasivelybromelainssacrilegessuprarenalcharladiesochlocratslavatoriesprankishlyassertedlyinterlacesgreaselesspolarizersgirandolesallethrinsaxillariescatalyzersliberatorsmoldboardsflatbreadsreclaspinglubricantsprosodicalcharlatansslatheringdollarizesensnarlingrevaluateshollowarestolerancesaversivelysuperlargehilaritiesmetalwaresblatherersinterlardsrebalancessupercleanfascicularclassworksrationalesrehearsalsadulterersdefaulterssulfuratesreanalysesalgorithmsblackbirdsmuscularlypluralismsreanalysisreclosablepatrollersstraddlingauslanderslinearisesreanalyzesrecitalistslaughtersafflicterspelycosaurpalliatorsultrashortpastoralesportrayalsreexplainsreluctatesretrievalsabstruselytrialoguesultraslickdeclaimerstailoringsultrasmallstrippablemaelstromsstragglersstreamletsclassifierflatterersreclassifyeditorialstransvaluecurtailerssporicidalslavocracyporcelainsimmoralismroadblockssimulatorsmarmaladesglassmakerimmoraliststeamrollssterilantsglasspapernailbitersnavicularsresiduallydisrelatedbrutalizesfilariasesshearlingslarcenistsidealizersscramblingsluggardlydispersalsnormalciesclamberersstarlightsperennialsbeleaguerscalamariesflagrancesrespirableconferralscurtilagesredisplaysburglarieslandloperssolarizingmillstreamparacletesaccursedlyformalisesplaisteredallograftsnormalizesstarvelingtelluriansembranglesespalieredribaldriescarrouselsskylarkersformalistsparalogismlaticifersaltercateslandownersmelioratesolecranonsprelocatesshirttailsconstrualsformalizeswelfaristsmarbelizesstalwartlytriennialsuitlandersalteritieschildcaresclavieristdisplacersstalworthsrelaunchesrepellantsresultantslatimeriaswassailersgrasslandssalutarilyadverbialsreelevatesdrinkablesgrassplotshairstylesbetrothalsshrievaltymainlinersdesolaterswallboardsmicroscaledisplayersworktableshousecarlsapplaudersserialiseslitigatorslogographsforestallsdesolatorsaeroplanesbeglamourssalesroomsephemeralsalderfliesaquarellesquarrelersoverscaledresealableeelgrassescelebrantsallostericcelebratesserializessubalternsgraticulespalaverersforestlandrearousalsbrambliestflavoringsbramblingsinauguralschiliarchslogorrheaslaypersonsglycosuriavaporouslyallotropespracticalsstrandlinecheerleadsgyrfalconsambulatorsrailleriesfillagreespictorialsslabberingneorealistcartilagesnontalkersmodulatorsresectablerigmaroleshorseplaysinstallersclapboardsdisenthralbranchletsconcealersplowsharessugarplumsbilharziasshortfallsrechannelschevaliersalgebraistsectorialsgratulateslustratingboulevardsurinalysesheartlandsrelevanceslaminariasguardrailsbroadscaleclearancesfalsifiersglossarieslarvicidesfluorsparsformulatesprolamineslethargiesglossatorscrenelatestarantulassemiyearlyalabasterspolygraphsravellingsbricolagesultrabasicunderloadsafterglowscracklingspyrolysatesearchableparaglidesstandardlydisbursalsalacritiesgladiatorsappraisalssloganeersmisrelatessuperclassoverclaimsanchorlessbillboardssanitarilyintranasalmacroscalespoliatorstutelariesfreelancesmarshlandspilferagesluminairesanglewormscaterwaulsliteraciespaperclipsacclaimerscirculatesrevictualscaracolersluminariasovercleansultradensemanslayerscalvariumsoverslaughritualistssignallersprehandlesidolatriesvaricellasplayactorsvitalizersspraddlingritualizeslabyrinthsreflationsmarsupialsbanderolesshrublandslagomorphslifesaversendorsabletravellersflowchartssparkliestcharbroilssolidarismvulgarisesbrowsablessheldrakesdrysaltersreenlargesvulgarizesquadruplesfederaleselaundererscathedralstablewaresblastoporerevivalismslanderersengarlandsballadeersassaultersreenslavesduraluminstransaxlesultraisticwaterfallsscrubbableallegoriesguerrillasvariolatesshellbarksparasexualregulatorsboardwalksroundballslachrymalsglamorisedsacralizedelaboratessacralizescatalogersplaymakerswaterfowlsbandoleerschargrillsauralitiescigarillosmartingalssubcentralvariolitessailmakersalfilariasracializesleafleterssalverformstaurolitealfileriassponsorialretaliatesflashcardsvarioloidsgranulatesbandolierscornstalksearthliestbackslideradrenalinsalbertiteszoolatriesballastersasteroidalparallaxesaerialistssailplanerasphericalarmadillosarsenicalsmutilatorsassemblersreescalatesucralosesalgarrobasneutralismglossaristgranulitesrectanglesreplicasesclepsydraeoutlanderstrevalliesalgarrobossclerotialscrewballstahsildarsringhalsesinterclassstridulatephalangerscanorouslyplicatureswaterleafshydrolasestularemiasfrancolinsglissadersgranulomaszealotriesrereleasescancellersswallowersorganismallairdshipswaterlinesgranulosisthimerosalballerinasloadmastercrosstalkspeculatorsvarletriesfinalizerslapidariesflashoversheadlinerstreacliestfulguratespolaritiessarcosomalcrosswalksmisrelatedbarrelagesreclaimersphalaropesauricularsbarrelfulsresonantlymiscallersovervaluesallergistspresagefulsalesclerkteasellersbromeliadsinterplayscarbacholsmilliariesosmolaritypleasantergirandolasbrilliantssupravitaltranseptalplacodermscomprisalscongealerssolitairescycloramastailboardsartfulnessoutlawriesresolvablesuperlunarbarrelsfullacquererssolitariesflackerieslubricatesrafflesiaspolymerasefearsomelyplagiariesrelocateescamelhairstailendersstringhaltmortarlesscarbamoylsmetalmarkslobstermanalongshorerenewablestreadmillsastragalusorganellespermalloysplastererscloakroomslakefrontscolombardsstairwellstabulatorsmilligramsbloatwarescharlottesmercurialsoutsparklealgometersstarflowervisualizerpartisanlybluebeardssaltarellochannelersclassroomstailgatersinsularismelastomerspsalteriumcarbazolesinsularitytoleratorscarpoolerscladogramssulfurateduniversalsamplifiersprincipalscajoleriesadulteriesbrushlandslakeshoresmadrilenesstraddlersdialoguersflatlinersblockaderspyralididslaterbornslinearisedtriclosanspluralistsheliogramselateritesclathratessquabblerstoolmakersreacclaimselateriumsparablastsparalyticsscrabblerstruckloadsalpenhornslanguisherfairylandsarterioleshailstormsqualifierssaddlebredchairliftsscrabbliernucleatorspluralizesclattererslinearizesnonmortalsultrasharpparalyzersscrabblinglogarithmsalligatorslibrariansinitialerssaddleriesluciferasegauleitersproplastidcallboardsswordplaysalbuterolssporangialsprigtailstraileristporbeaglesprelatismsblackenerssupermalestamarillosultrasmartsimulacrespastorallyflattenerssaddletreespringaldsarecolineshaustorialbedragglesrecatalogsresaddlinglibrationslipreaderstrailheadsrelacquersscarlatinalinecasterdayflowersdeclarantsstraggliernavelwortsswordtailsportulacasholographsreptilianseldercaresmicrosomalanimaliersgesturallyprelatureseasterliesgrossularsimmolatorscarbolizesscragglierbrutalisesscallopersdesirablesastrolabesprotoplastflashboardmarlstonesstericallyalienatorsprecancelsbairnliestberascalednonserialsbatfowlersslavocratscascarillavictualersreinstallspostulatorinterloanssufferablyblazonriesglassworkscymbaleersmelaphyrescurtalaxesresalutingrevelatorsscalogramsmyrobalanslacustrinesubnormalsglasswareshairclothsharborfulsbraillistslandgravestailwatersagrologiesallocatorstrainloadsharborlessresamplingcatcallerstriathlonspellagrinsglasswormsscramblersskedaddlerpellagrousglasswortsmoralitiesisallobarsmultiparassolarisingaerologieslamaseriesleprosariaorganosolsparbucklesslatternlymoralizersnormalisedlucubratesphilandersgrapplingssupernallynormalisescentralisesubcrustaldilatatorstrabeculastriticalesclostridiasolitarilydoorplatesexplainerscaramelisecentralismlawnmowerspalaestraeunpastoralcentralistradicalisefastballerpalaestrasplutocratsgraspinglyprostomialcasseroleslathyrismstranspolarallographsareologiescarbonlesssaltpetersformalismsblearinesscentralestchaparralsparvolinesaspergillasandlotteraspergillisaltpetreslawyeringscolorcastsisochronalentanglerstrinomialslusterwaregasholdersskylarkingaspergillspalmistersgeneralisemanipularstribalismsplanarianskohlrabiesfalconriesfactorialsallomorphswelfarismsmetralgiastribalistsspiracularturntablespearlashesjaywalkerscurveballsfloricanesglazieriespyridoxalsmarbleisesoversaltedkiloparsecmarbleizessubdealersworkplacesgrimalkinsprismoidalbrazileinsacyclovirsheraldiststrehalosesalternantsheraldriesbolographssalureticslarghettosparadisialundulatorsspritsailsmiserablesplagiarisethralldomspaloverdesalternatessafflowerslambruscosoleographstreillagesrelaunderscervelasesmisalteredmajuscularparamylumscarbunclesaliteratesherbalismssalesgirlsbacterialsherbalistslamebrainslevitatorsserialisedtrifacialspharyngalsantiliferssaprolitestracheolestrammelerspsalteriessibilatorstelegraphsgrindeliasserialismslegwarmersmycofloraserysipelasserialistsfallboardspiperonalscartelisedmarcellersadsorbablenonpareilstribulatesaeropulsesamoralismscartelisessquarishlyalizarinesapplecartsrootstalksburladerosdwarfishlyoverpedalsgreenmailsmislaboredoverlaborsworldbeatsbaselinersrailbusseslitterbagsargillitescotylosaurbreadlinesaltigraphsbroomballscartelizeslovemakersaltimetersarchangelsbroadbillsmestranolsdiableriesflavoristsruralisingsalvarsansmisleadersdekaliterspersonaltydekalitrestranslatedpalsgravesfarandolesantichlorspeninsulartranslatesrosemalingmislearnedroyalmastsruralitiesmarchlandsneorealismnorthlandsvernalizesscratchilyrecountalssporulatedtrackballssporulatessuperplanewallpapershyperbolasremouladeslocalizersobligatorsthreadlessbreakablescorrelatesneuralgiasliteralismplanisherslazarettesliberaliselazarettosspermatialsuperflackliberalistaltostraticellaragesreasonlesscorneliansnulliparasoriflammespolywatersrauwolfiascaptoprilsstranglerstrivialistperpetualscalcareousbroadloomsradiolysischrysalidsoverlavishtubulatorsmacromolesfalseworksperiplasmslangridgeswallydragslustrationmonocularsoverplaidsperiplastsisocaloricslackenersdrawerfulsreimplantscrabapplesgladdenersglossarialaardwolvesverapamilsafterclapsalkalizersprolactinshorsetailslaminarinslorazepamsquadrillesincurableslowercasedschmalzierlowercasesnonplayersgrisaillesgyroplanesoverplantsgardenfulscellarwaysoverlearnsreassailedbroadtailsrocambolesspiritualsocularistsoverglazesscrawliestrijstafelssalimetersprolapsingrijsttafelchivalrieslaryngealsseculariseravelmentsbrandlingsmelodramasmyelogramsbrowalliascarneliansdrawplatescampestralsteelyardsverbalismswarlordismgerfalconsreswallowslowlanderslumbricalslaminatorsabolishersverbalistssearchlesscorallinessocializerafterlifessecularityshmaltzierafterlivesgastrolithradiolysesrestablingseignorialsolfatarasverbalizesprimatialsbreakwallsescaladersviscerallylockmakerscoralrootsenalaprilsparflechesfilmmakersclearweedssaltcellarlimewaterscraterletsidolatrousmayflowersequalisersparfleshesrainsquallclearwingsreprievalsbiradicalsblandisherresemblantrosanilinspapergirlscartwheelsdepilatorsescalatorsvalorisingclearstoryritualismsromeldaleslifeguardsequalizersescalatorydicumarolstablaturesenamellersoverclearshammerlessversicularbacklashersuperalloyrusticallypreappliesimplantersclarifierspilgarlicssalivatorssupersalesblastodermpresignalscarvacrolsextraboldspolltakerscrackliestspectrallyvulgariansreplasterstrihedralsgaribaldisvulgarisedcarambolassurprisalsnewsdealerlaserdiscscontraltosshrinkableearlywoodsfloweragesprothalluslaserdiskssolidaristfieldfaresvulgarismsclarionetsdrysalterytraversalsfunicularsinhalatorscablegramsblastomereprevailersgradualismchloracnesscreenablesparkplugsspirulinasminelayersneurogliastrochlearsunderclayspiroplasmaparasailedpercalinesgradualistjarlsbergssalutatorydelegatorsleopardesspiroplasmshalftracksrepleadersimpleaderssuperscaleexclaimersforeladieschloralosemeltwatersleadscrewspropagulesharlequinsreviolatesmineraliseultraheatspargylinesphyllariesrangelandsrevivalistslanderingsmallswordsprattlingdreamlandsarchivoltsharlotriesretailingsclipboardscolcotharspyelogramsscabrouslyprevalentssaucerlikecuadrillasgranolithsreenslavedreservablesinoatrialsoftballercalenturesliteratorsmisdealersnonlawyersplaygroupsgastrulatespecularlymillboardssailboardschlordanesspurgallednatrolitesflarebackspillarlessirregularssailboatermicroloansacrosticalchlorellasouttravelsvocalizersunsnarlingmesodermalcoralbellsreinflamessprawliestparalegalsmeasuredlyballadriesbrasileinscurlpapersbranchlessgermplasmsdecalitersmalaproposcarnassialscrublandssubcellarstotalizersunclearestallegoristreinflatesroundelaysmirabellesosculatoryfireplacesxylographsracialismsregalitiesglamorisesscleromataestradiolsracialistspartialistpatrialismlossmakerswaterglasscaliatoursbandolerossailoringsrhone-alpescoalminersasterismalwestwardlycanceleerscanoodlerssailorlesslaurustineparalipseszoolatriassailorlikeestrangelophalaropuslegatarieswhirlblastzoolatrouscardcastlerecalmentscleopatrassepulturalsnarlinglypersonaliacanceliersfrontstallemplastersbicapsularamaryllidsrhopalismsdefloratespalisandersclerotalslunarnautsgaiterlessemplastronfinaliserspulpboardsrecanaliseneuroplasmmaladdresshalicoeresemplastrumbarrelfishsogdolagersubtitularrevalentassidereallymonolaterssupralunararcologieslaryngitescapitularssilver-graysoleiroliauralitisedgastralgiauranalysisuralitisesmarischalsstylographthroatlashtonsillaryparacelsusrallycrosssalvinorinfriar's-cowlconsortialtransposalpolariserscerealistsxylorimbassilver-lacehandle-barsesclandresextrasolarcensurablyuralitizesrevalorisecatalysersjerfalconskaliuresisarbalesterranshackleshauchlierglamourisemortalisedtetrapolisuranalysesmortalisescosmolatrypursuantlydollarisedparkleaveswanrestfularbalisterblastoporsseborrhealdollarisesmailsortertrimestraloverrashlybelisariusvirtualiseglanderousashlaringsassertiblepalestrinaranshakledranshaklessarcostylesolitarianmortalizesparalogiasparastatalclericatesparalogiesransomablescaldberryseveraliseallomerismparalogisevirtualismseveralizestarchlessallomerouskalotermespalletiserashleringslincrustasgraminalesstairliftsstarchliketragelaphsfenestralsvirtualistplayscriptclubmasterdollarlessarctophilsransomlesspraxitelescrotalismsstrabismalparietalestreadlingsparalogistrectorialssequestralsmall-earedsurveyabledisinthralthyrsoidalastragalargalravageswranglingsbeplastersresorcinalschoolwarddiscipulartarsalgiasdollarshiprelocatorsrostellatelateralisesalicorniasquiralitytantaliservisualiserburglariseforinsecalgeolatriesarcubalistscarletingsprekeliasparlementsbrassavolaslatteringstraylingsnuclearisestarchedlyrinkhalsessaltarellidisapparelforbiddalspleasurersrantipolesbrattlingssilentiaryunsavorilypluralisedgoliardiesrepolarisepistillarypluraliserscaleboardrelativisechoralistsfortilagescladrastisantiworldsreanalysednicrosilalpluralisesgalumpherspreisolatespagyricalsuperloadsfloodmarkspolemarchscurselarieparalysersfrugalistsalpargatasportolanossaliferoustetrastylelamarckismparleyvoosfairyflossfavourlessadulteriseastroblemepericallisorchidalespostmortalself-hatredalligartasprocessualinterposalthalarctostrialitiesbluish-grayarblastersflindersiaundersealsminuscularparisologyquasi-royalstreaklikelactariansblepharismprelationszircalloysbeslaveredbluebreastcleruchiasslaughterytriallingsarmourlesslaterisingsexangularmarlaciousfairytalesprelatisedlandboardssavonarolalibrairiestriallistsparablepsyflatscreenprelatisesserradellasporadicaltreatylesstrisulcatescaleworksvascularlysaddleroomserradillaflatsharesprebuttalsaustraliteictericalsbelamouresrevealingscranefliessquadronaltrialwaresentrammelsastrofellslanddrosestheralitesastrolatrypluriparasantrorselyprelatistshalocarpuspowerplayscarbolisedlanddrostscorporalesstreamlesstelferageslactophrysuredinalesclamatoresrotaplanescarbolisessdrucciolasavourlessglucosuriaeasselwardunprisableprelatizesharassedlylapstrakescourbarilsstreamlikeleptospirafloorheadsradialisedhumoralismrhagoletisfissurellasurmisablebarrowfulsradialiseslapstreakssertularialactosuriaparabolisehumoralistmalaxatorsstreamlingswan-flowereasterlingvictrollaszelatricesserrasalmoself-loaderflatterousalcarrazascarfufflesscragglinggalsworthyswanflowerwaldgraveszelatrixesresaleablesororiallyparabolistalcatrasesbrutalismsbimestriallophosoriaagrodolcesalphasortsastrologicparalepsisseminariallandforcessimulatoryspringhaltnocturnalsblacksburgidealisersbrutalistssaltigradecollapsarsmarmalisedmelanuriassunderabletriapsidalradializescalabresescalligramsmarmalisesblackshirtgaldragonsweasellersfistulariaschwarzlotbushwalkercryocablesmoralisersbargepolesparalipsisreapparelsmarmalizesaneurismalinfusorialdevaloriselaurentiusultraviruseastwardlyagrologistgovernallsdollarfishcheraliteslatheriestgalvaniserpasturablefilatoriescaprifoilssexlocularshirraleesarbuscularproposableholophraselardaceouseternalistcaprifolesscuddalersmailmergescheckrailslamaseraislardalitesmillocratsinterdealsnarghiliesaerologistgeranialesstrobilatesubcranialself-praiselawmongerssubversalsinterrailsgargoylismmarmelisedparcelwisephraselessserrulatedmarmelisesmouldwarpsprayerlessreticellaspetrolagesformaliserplainworksastrophelshyoplastrasocdolagerpalaestralcasseroledsternalgiastrainedlynetballersassertablewreathlessimbranglessialogramsmarmelizesstallengertelluratestrophesialpalaestricflaughterssternalgicfeldscharsgaolbreaksbalnearieslathyrusesmulattressrecyclatesdharmsalasunapparelsgrillsteakprimulalesstallingerdharmshalaenrancklesanswerablyhinderlanscaprylatesforeslacksfrabjouslyareostylespolystylarincisorialcalandriasclavicornsself-regardmarbelisedcrownlandsanswerlessbannerallsmarbelisesoversailedvelarisingrattlebagsmitraillesverbalisedslave-makerverbaliserwalkshortsspirulidaelockmasterchapelriesspiraculumvassalriesrewardlessclamourerslevigatorssubordinalsupervisaldioestrualthermalisepalamporesplatemarksauthorlesscross-modalbasaltwarehourplatesjournalisesolderableflorideansblackstrapsnowbladerspiralismscarrytaleseurotialeschildermassouth-polarstillatoryemulatressmelampsoraporisticalapologiserspiralistssportsballisofluranepearlinessglomeratesheraldshipladieswearlargitionsseptrionallandsharksall-purposefaldistoryplenartiescurly-headsstartinglysuperexaltlap-strakedbalthasarsoricalchesball-busterbalthazarsharuspicalbaseballerremoralisehorse-trailartisticalinspirablesubdeliriauncharnelswallchartsstrokeplaymelanerpespostocularmegaflorasmullarkiesoleraceouspardaliseslyre-shapedpsalteriantriumphalspearlwortsrentallerssaproliticpardalotesgilravagessapropelicfirst-classsibilatorystartlingsdesolatorytelomeraseasphaltersbalusteredabsolutoryarpillerashyperrealskailyairdsaerosoliseill-starreddratchellsradiculosehydrosomalinerasableinerasablyfiligrainsamoralistsbalzarinesinerasiblesubstellarsulphuratelapidaristpresentialinerasiblyinsalutaryfiligranescartelismsrijstaffeldiurnalistsubangularabsolvitorroyalisingcartelistslopgrassessugarallieervalentasaeroshellsquadrellasbladeworksroyalisticlocalisersdespairfulpardonlessvernalisedmegalitresvernalisesstrandflatworldscaledextrorsalhardlinersclimaturesmalnourishnormaliserroselliniamagistralspotwallersbrickclaysregulariseverdolagaspasquilersgalleristssalpichroashieldrakeflavourersabsorbedlyclarksburgpyroclastscalorisingstrandwolfbelshazzarslabberersdelustrantsuperphylareperusalscarmeliteslatrationslectoratesmacrogliasjoculatorssegregabletramplingsmandrillusstreet-walkalopecurusvisitorialrascaillessnaileriessubstrataltremolantsliteraliseunderleasewallpostercircensialmournivalsvolksraadsrascaldomsmarrowlesseternalisefederalisesigillaridstreetwalksyllabariapalemporesrascalismscarnalisedclapbreadscolourantsseraphicalsubarticletrivialismphrensicalcarnalisesagaricalesalzheimer'sebrilladesbroadlinesscansorialdismantlervapourlessaltricialsrascallionrhizocaulsflavivirussaddle-soreradiogoldscarnalismstrampolinspilasteredaleatoriesscrattlinglattermostcolourfastmallandersalkalisersquestorialperistylarpopularismcalcsintercarnaliststremulantsremovalistisotheralstabularisepyrolaterscanneluresouthaulerslizardfishpractololsreissuablecarnalizessarcocollalustrativetranslucidtremulatescellaristscrashlandsstimulaterapresolineupper-classneuroblastsceleratesepiplastrareasonedlybipolariserigsdalersleisurablelustrewaresocialiserteleosaurspraeambleslaminariseleisurablyheartlingsbrickwallsscrollableclearcolesgriseliniadescramblealpestrinealectryonswaghalterseleocharislarvikiteslethargisewaxflowersarrestableeresh-kigalscheffleramarshalersforegleamspuristicalreistafelsereshkigalcarnarolislabourismsmareschalsstraplinesressaldarsmatriculasfebriculasalablastergardenlesslabouristsmarshallersteelwaresdisentrailgastralgicaspiringlysalimetricorinasallylyssavirusperisarcalbutleragesscrawlingslaboursomeflavourouskaryolysesverbalisesfalteringspalustrianbraaivleisstadholderpalustrineparaglossaplugboardsdulcamaraskalamkarismallenderssquaretailsuccorableoutplacersfrikkadelsprolationsbandalorescolourwashmicrogliasharestailssilvertailcorallitesstrophicaldrabblingsoestradiolclearskinshalf-sisterbranglingssakartvelobrunfelsiaperishablyalembrothswarmbloodssolfatariccraterlessspoliatoryshillaberscolourwaysslaisteredmelodramesidolatressdicranalespassifloraclarendonscoralwortsmarshlockssurnominalvitalisersgoslaritesvulcaniserlotus-eaterautoflaresrosanilineshad-flowerdiscoursalearlieriseplumassierjuristicalgastrologyritualiseddangerlessaftersalesritualiseslaniferouskaryolysisarchilowescalembourslanigerousluminarismracemoselyshopwalkerspracklingkaryoplasmgradeliesthariolatessclaundersluminaristsparkishlyflustratedracemouslycalocedrusflustratesbandelierscrystalisebarophilesidolatrisesermonicalfarinoselyjaculatorscochlearessinistralsshadflowercurialismssuperaltarleaderenesacarpeloussubcalibervulgariserbreastrailsardonicalcurialistssubcalibrelawyerbushconsimilarstatolatrytravelingsperiblastsprecocialssupersaltsarchiplasmisocrymalsvalproatespatronlessbarbastelsholarchiesbridlewayssparklingsmonostylarcarambolesunrealisesgremolatassallendersperistomalnanoworldsunrealismslaserwortsslammerkintargetlessbalsamrootscleriasescolubriadssuccursaletradesfolkparsonicalscleriasischloralismspranglingdreamholeslarge-scaleunrealizesfirefloatsforsakenlypterygialsrivalessesscleredemasucralfatesuccursalslower-classbescrawledurolagniasindorsablerouncevalscolourcastcalendrersmarialitestetraskeletarifflessflapperishbestraddleholderbatscalendriesrivalisinglacertianssylvestraltotalisersvocalisersglairinesshospitalercalypterasrivalitiessaucerfulsunerasablemalvastrumsaucerlessshellackercrossclaimsprauchledparakeliaswildgravescarollingsclartheadssemi-formalsprauchlesoverhailesbreastlessfieldwardsrecalescedrevisionalsacralgiasmartialismmineralistunrealisedmalversateworld-classvarifocalsgressorialscholarchslanterloosflaptracksforslackedaristologyrhoeadalesmartialistpillaristsinsertablechargelessfoliaturesaristotlesharmalinesrealisablerecalescesrhachillassacralisedsallyportslanternistlauraceousfront-stallalphavirusparalaliasgrevilleasrealisablysacralisessalamandralegaliserslongboardsaldotrioseparaselenevalvassorsvulneratesdepolariselivraisonssterculiasstridulantsymbolatryepisternalpraiselessfarnarkelsvillagreesaraeostylecalfdozerssalmanaserpartialisealbarellosracialisedrivalshipsclipshearscordialisemesmericalearthfallschristellaracialisesrecruitalssalmanazarscaffoldershelldrakedecalitrespatrialisepraisinglyglamorisersampleriessauromaluspericlasesarchoplasmattolasersmatterlesscrossfallsparalexiaspartialismcoalmaster
Phrases (313)
lake nasserel salvadorblood sugarwool greasesales forcelarus canusslack wateralan seegeros frontaleair marshalsun parlourportal sitelead astraymale orgasmmale personchoir stallmoral sensestrip alertoscar wildeatlas cedarsmart alecksignal firemetal screwfalse alarmscarlet oaksalix nigragenus larusplastic artbalkan warssoccer ballmajor scaleslave ownershoe collarsecret planrose mallowsalmo salarstan laurelleaf scorchturn signalsoluble rnaeaster lilyj. d. salingerraja laevisnatural gasfranz lisztwater glassrock islandstrong galestreet lampsocial rankst. polycarpres publicasaddle horngreen saladsexual urgelabor painsactor's linee. g. marshallmaple syrupapril fools'stable gearletter casecarl rogersspinal cordsir galahadlawyer bushlion's beardbalsam herbsolar flaregreat fallsparcel postsalad greencolour washscratch awlsperm whalelook acrossmuster callgenus lutrahard solderplay tricksebola virusgeisha girlstep laddercover glassfish laddergarage salegross salesused-car lotcrown glasspearl s. buckslide chartcalf's brainsierra plumcalf's liverlazar houseultra viressea lampreywalter hessrhus glabrabengal rosevisual areaplant virusstrand wolfiris familysmall hourssilver hakeminor scaleslight carewild radishsmall printwaste balerwhale sharkon all fourssilver sagelever scalesardine oilcow parsleydevil grasssable brushsilver starstony coralsugar applejuan carlossugar maplealaska crablemon grassmale orchisspirit lampglass fiberburial siteglass fibresugar shelldouglas firsun-ray lamplemon sharkreal estatelee krasnercress plantamsler gridcat's cradleplume grasssea trifolysailor kingsailor suitalkyd resinscarlet cupschool yearscarlet hawlanseh treelassa feverthird classlassa virusfruit saladgenus selarrolled oatsdollar signreal tennisjoel harriscrawl spacesanta clararush candlegenus larixrush familylast hurrahrhea silviaallyl resinnew orleansladies' roomcamel's hairlock washernew realismdorsal hornfalse fruitsacral veinangel sharkdorsal rootlast resortbrown snailrose familyforced salesaint cyrilscrub planelast supperslave tradesally forthfalse laborgarlic saltcelery saltlord's tablemarsh elderarm's lengthsloop of warstrix alucocurly grassdewar flaskcamera lensblade roastfalse morelleaf springpapal crossshariah lawsmilo grassst. lawrencealnus rubramarsh plantstroke playaerosol cannettle rashlaw of areasaxle greasesunray lampcloud grasssmoke alarmsquare dealbasic colorspark levertax shelterdish aerialpurple sagesquare mealsaddle roofrock salmonsquare mileblank verseloss leadergrab sampletabula rasadar al-islammaster filesocial workalcea roseaclip artistsquare sailbreak looseleo szilardquail brushfirst of allangler fishmaple sugarallen screwtundra soilfats walleralpha brassgas guzzlermurphy's lawsand dollarsalt shakermaster planroyal flushroyal houserumble seatoral herpesjulius marxlule burgasgrape lousesand lizardgrad schoolsand myrtlevernal irispatrol shiplease giversolar arrayice crystalbush lawyerparsley hawharbor sealverner's lawcrystal setoccult artscrystal teacor anglaiskepler's lawstator coilwall streetshore leavescrap metalgulf streamleast shrewmustard oilbalsam pearsalad creamserial portsolar housesolar monthsolar panelpostal cardprickly ashlatin crossblack storkfiscal yeargolden startarsal bonesolar powercoral dropsdouble starnaval brassrecall dosegreat lakessky marshalcharles viicoral snakecrane's billulmus rubraold frisianharvest flyvulvar slitsafety railkaiser billweasel wordkaiser rollseckel pearsaale rivergila desert
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen