10-Letter Words Containing: K,L,A,N,G,S
(In Any Order)
There are 20 10 letter words,
9 10 letter phrases and
0 10 letter abbr's with
K,L,A,N,G,S in.
Best Scoring 10 Letter Words With: K,L,A,N,G,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| skylarking | 10 | 22 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
| lawmakings | 10 | 20 | ||||||
noun • the act of making or enacting laws | ||||||||
| cracklings | 10 | 19 | nounn | |||||
noun • the crisp residue left after lard has been rendered | ||||||||
| slingbacks | 10 | 19 | ||||||
noun • a shoe that has a strap that wraps around the heel | ||||||||
| gavelkinds | 10 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| gangplanks | 10 | 18 | nounn | |||||
noun • a temporary bridge for getting on and off a vessel at dockside | ||||||||
| sneakingly | 10 | 18 | adverbadv | |||||
adverb • in a sneaky manner | ||||||||
| ankylosing | 10 | 18 | adjectiveadj | |||||
verb • produce ankylosis by surgery • undergo ankylosis | ||||||||
| slackening | 10 | 17 | verb, adjectivev, adj | |||||
noun • an occurrence of control or strength weakening | ||||||||
| grimalkins | 10 | 17 | nounn | |||||
noun • A cat, especially an elderly female. • A bad-tempered old woman; a crone. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (20)
slackeningspankinglygangplankssneakinglycracklingsslingbackslawmakingsskylarkinggavelkindsgrimalkinsankylosingalkalisinglossmakingginkgoalesgolomynkasspeakinglymaskalongespracklingsparklingspokelogansPhrases (9)
king salmonglass snakesailor kingblack angusenglish oaksex linkageangel sharkleak fungusshingle oak
