10-Letter Words Containing: ITTER
(In Exact Order)
There are 53 10 letter words,
4 10 letter phrases and
0 10 letter abbr's with
ITTER in.
Best Scoring
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| zwitterion | 10 | 22 | nounn | |||||
noun • A molecule, such as an amino acid, that carries both a positive and a negative charge. | ||||||||
| acquitters | 10 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| jitterbugs | 10 | 20 | nounn | |||||
noun • a jerky American dance that was popular in the 1940s verb • do the jitterbug | ||||||||
| shipfitter | 10 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| jitteriest | 10 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chittering | 10 | 16 | ||||||
verb • make high-pitched sounds, as of birds | ||||||||
| bitterweed | 10 | 16 | nounn | |||||
noun • widespread European weed with spiny tongue-shaped leaves and yellow flowers; naturalized in United States • any of numerous chiefly North American weedy plants constituting the genus Ambrosia that produce highly allergenic pollen responsible for much hay fever and asthma | ||||||||
| imbittered | 10 | 15 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
| embittered | 10 | 15 | adjectiveadj | |||||
verb • cause to be bitter or resentful | ||||||||
| skittering | 10 | 15 | verb, adjectivev, adj | |||||
verb • to move about or proceed hurriedly • glide easily along a surface • cause to skip over a surface • twitch the hook of a fishing line through or along the surface of water | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words With ITTER In Order
Words (53)
babysitterbitternessglitteringmitterrandglitteratiimbitteredoutglitterlittermateantilitterembitteredoutfitterschitteringlitterbugsskitteriertwitterersflitteringzwitterionjitterbugsacquitterspermittersskitteringtwitteringfritterersbitterrootjitteriestbitternutssubmittersfritteringbitterweedlitterbagsshipfitterbitter-barkgitterningbitterwoodunlitteredbitterbarkclitteringbaby-sitterglitterandfive-hittermanumitterbitterlingcommittersforebitterfour-hitternitwitterypipefitterwhitterickglitterierbedsitterstitteringsembittererwhitteringPhrases (4)
bitter sparlitter loutbitter dockpipe fitter
