10-Letter Words Containing: H,I,S,S,E,D
(In Any Order)
There are 136 10 letter words,
5 10 letter phrases and
0 10 letter abbr's with
H,I,S,S,E,D in.
Best Scoring 10 Letter Words With: H,I,S,S,E,D
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
judgeships | 10 | 24 | nounn | |||||
noun • the position of judge | ||||||||
dysphemism | 10 | 23 | nounn | |||||
noun • an offensive or disparaging expression that is substituted for an inoffensive one | ||||||||
bakshished | 10 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
sheikhdoms | 10 | 23 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
sidechecks | 10 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
phosphides | 10 | 21 | nounn | |||||
noun • Any binary compound of phosphorus, especially one in oxidation state −3. | ||||||||
dishwasher | 10 | 20 | nounn | |||||
noun • a machine for washing dishes • someone who washes dishes | ||||||||
handspikes | 10 | 20 | nounn | |||||
noun • a metal bar (or length of pipe) used as a lever | ||||||||
skirmished | 10 | 20 | verbv | |||||
noun • a minor short-term fight verb • engage in a skirmish | ||||||||
ladyfishes | 10 | 20 | ||||||
noun • A coastal dwelling fish (Elops saurus), found throughout the tropical and sub-tropical regions. • The Spanish hogfish (Bodianus rufus) • Albula vulpes, one of the fish called bonefish. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 10 Letter Words
Words (136)
astonisheddishwashersisterhooddishonestytheodosiusnightdressmethodistsgoldfishesemphasisedhesperideshorridnessshoddinesshiddennessmethodisesshirtdresseuphausidsdispatcheseldershipsdianthuseshydropsieshandspikessandwichesskirmisheddemolisheshorsehideshousemaidsdiminishesdepolishescrispheadsridershipsdischargesrhapsodiesmethodismsmishandlesstairheadsdamselfishtoadfishessphenopsidmisphrasedtherapsidshistidinessandfishesdovishnessstudfishesmodishnessswineherdsheraldistsshorebirdsdysphemismbakshishedladyfishesstablishedcadetshipsdrumfishesbrandishesadmonishesdishtowelsdishwatersstandishesphosphidesblandishessheikhdomsdealfishesbirdhousesnightsidesshadowiestsidechecksjudgeshipssidelightsheadfishesrodfishersbedelshipsdisflesheddisfleshesdolichosesdisk-shapedanhidrosespholidosesdisinhumesdisvouchessideshootsguideshipssyphilisedduchessinghoydenismsdispathiesdoughinesssherardisepseudechissidewheelsstarfishedtolldishesdyspathiesdithelismsheadsticksminidishesdysphagiesshreddiestshreddingsrhapsodisescomfisheddecastichsseemlihedsdrowsihedshybridisesdysthesiasdisthronesfetishisedwidershinsswinehoodsdisherisondisplenishshieldingsdiorthosesshieldlessdochmiuseslustiheadsdisbenchesdish-shapedclapdishesscumfisheddevilshipswindshakesshrew-sizeddisc-shapedshroudiesthansardiserhodanisesshopsoiledgumshieldsmindsharesdiphysitesdissheathetightasseddisshiversdauphinessPhrases (5)
brush asideseed shrimpswedish ryedish washerdress shirt