10-Letter Words Containing: H,H,I,S,S
(In Any Order)
There are 79 10 letter words,
12 10 letter phrases and
0 10 letter abbr's with
H,H,I,S,S in.
Best Scoring 10 Letter Words With: H,H,I,S,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hypophysis | 10 | 26 | nounn | |||||
noun • the master gland of the endocrine system; located at the base of the brain | ||||||||
| hexastichs | 10 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| chiefships | 10 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| bakshished | 10 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sheikhdoms | 10 | 23 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
| bakshishes | 10 | 22 | nounn | |||||
noun • a relatively small amount of money given for services rendered (as by a waiter) | ||||||||
| shashlicks | 10 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shammashim | 10 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shrewishly | 10 | 22 | adverb, adjectiveadv, adj | |||||
adverb • in a shrewish manner | ||||||||
| hypothesis | 10 | 21 | nounn | |||||
noun • a proposal intended to explain certain facts or observations • a tentative insight into the natural world; a concept that is not yet verified but that if true would explain certain facts or phenomena • a message expressing an opinion based on incomplete evidence | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (79)
hypothesisdishwashersheepishlyhypophysisinsheathesshoeshinesmishmashespushchairscherisherssheathingsbakshishesshanachieshorsehideshorsewhipshighnessesmaharishishexastichsshashlickslightshipsmishmosheschiefshipsrhythmistshemistichsshammashimhindshankshindsightsdishclothsdishdashasbakshishedschlemihlsthrashingshorsehairshalachistshalakhistsshlemiehlsshorthairsrushlightsarhatshipsshrewishlyshillalahsphosphidesshillelahsphosphinessheikhdomsheightismsphosphiteschelashipswhiplashesthaneshipsheadfishesschechitasichthyosischainshotshibakushaschurchismsrhythmisesushershipsshoshoniansheathfishsheathiestshamianahsphilhorseshealthismsshechitahssubahshipsshibuichisbashawshipdish-shapedwishy-washyshrimp-fishshrimpfishsachemshiphephaistosthreshingsdissheathehyphenisesrajahshipshyphenismsichthyosesPhrases (12)
high statusshish kebabshoe polishshort whisthigh seasonshire horseschool shipsash weightshiah islamdish washerbishop's hatbush shrike
