Dictionary Only:
Profanity Off:

10-Letter Words Containing: G,G,A,N

 (In Any Order)
There are 373 10 letter words, 74 10 letter phrases and 0 10 letter abbr's with G,G,A,N in.

Best Scoring 10 Letter Words With: G,G,A,N

Expand?WordSave?LengthUsagePointsType
zigzagging10
32 verb, adjectivev, adj
noun

• an angular shape characterized by sharp turns in alternating directions

adverb

• in a zigzag course or on a zigzag path

adjective satellite

• having short sharp turns or angles

verb

• travel along a zigzag path

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

logjamming10
23 verb, nounv, n
Valid word for Scrabble US
paganizing10
23 verbv
verb

• make pagan in character

graecizing10
23 verb, nounv, n
verb

• To render Grecian, or cause (a word or phrase in another language) to take a Greek form.

• To translate into Greek.

• To conform to the Greek custom, especially in speech.

hypnagogic10
22 adjectiveadj
adjective satellite

• sleep inducing

aggrandize10
22 verbv
verb

• add details to

organizing10
21 verb, noun, adjectivev, n, adj
verb

• create (as an entity)

• cause to be structured or ordered or operating according to some principle or idea

• plan and direct (a complex undertaking)

• bring order and organization to

• arrange by systematic planning and united effort

• form or join a union

legalizing10
21 verb, adjectivev, adj
verb

• make legal

stargazing10
21 verb, nounv, n
noun

• observation of the stars

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (373)
engagementaggressionorganizinggraduatingstaggeringbargainingexchanginggeneratingstranglingmagnifyinggratifyingorganisingsabotaginggorgonzolanavigatingcongregatejuggernautgargantuanregulatinggarbagemanunchangingrechargingswaggeringdisengagedlegalizingsignallingimaginingsemigratingchangelingtailgatingdisgracingfumigatingzigzaggingdiagnosingstargazingtriggermanhypnagogicreengaginglaughinglyleveragingsandbaggedirrigatinguntanglingstragglingstagnatinggingersnapprogramingdelegatingagglutininingrainingabrogatingdegaussingharanguingembargoingelongatingoceangoingaggrandizerelegatingunflagginglitigatingenvisagingglaswegiancongregantgangrenousdegreasinglegalisingbrigandageaggrandiseengaginglyclangoringalmsgivingalgolagniaanagogicalanguishingligaturinggarnishingglamouringcragginessensilaginggatheringscomanagingdragginglychagriningglancinglychinwaggedcongealingdragooningendamagingcaregivingvegetatinggangplanksastringinggalumphinggarrottingdamaginglyjaggednessdialoguingengraftingengrailingunsnaggingengrainingoutgainingflagginglytobogganedtobogganerdefraggingoutgassingengravingsderogatingmitigatinglogjamminglevigatingoutarguinggallantingdisengagesaggressinggambollingingraftingaggrievingdraughtingarraigningscavengingobligatinggalleryingnegativingregrantinggadrooninggladdeninggametangiagloatinglygregarinesgargantuasindagatingmisgauginggarlandingpackagingscogitatingarrogatingrealigninggarlickinggarmentinggearchangecatalogingassegaiingpressgangsgraffitingrenegadingangulatingleagueringbeflaggingstravaginggangbangerglissadingpargettinggangbusterregelatingdesugaringgigantismsjugulatingganglionicearwigginggreateningbalbriggangaufferingmortgaginggangreningoutranginggrosgrainsclaughtinglawgivingsscraighingorganologyunguardinggantletinggrapplingsgraspinglygalingalesentanglingoutglaringgreengagesangelologyunchargingfraughtingredamagingestranginggoddammingoutgnawingbegladdingredarguinggorgonianssingalongsniggardinggarbagemengimballingpaganisingsynagoguesdivagatingregraftingglaciatingsegregantsrechangingpaganizinggeminatingbegroaningabnegatingangiogenicangiogramslangridgesdemagogingderaigningpaginatingabsterginggrangerismdognappingseignorageaugmentingmargentinggravellingbadinagingfaggotingswigwaggingparagoningreflaggingassagaiingpargetingssandbaggergaingivingoperagoingplaygoingsgallonagesshagginessdiagramingmisgradingraggednessslanguagesshaggymanegainsayinggraecizingcagmaggingevulgatingorangutangupdragginghandbaggedquagginessbagpipingsaccoragingbagswingerquagmiringaveragingsmamaguyinggangboardsgorgonaceagarottingsmangemangeequipagingvoetgangerdragoonagethingmajigagregationgangliatedtwanginglygangliformwranglingstwanglingsgeologiansbangsringsengraffingbragginglyalligatingilang-ilangdebaggingsgenealogicgod-fearingtragopogonorganogenyorganogramscragglingdisgradingflagginessprogradinggasbaggingvinegaringgaldragonsguomindangengraspingginkgoalesknagginessgalengalesengrenagescottagingsencharginggroundagesburglaringmessagingsflaughtingrampagingsylang-ylangnintinuggagaliongeesgambadoingenguardingnyiragongogabionagesrampauginglong-actingkarangaingalms-givingenraungingshoegazingvintagingsarpeggionebordragingspanglingsbaggagemanniggardiseniggardizeassuagingsfatigatingwagglinglydegearingsregratingschittagongwaggonettewaggonlesssanguiningwaggonloadscraughinggrangerisegraunchingergatogynelanguaginggardeningsbeguinagesracegoingsguarishingsaginatingknightagesgrangerizealgolagnicdognapingsgametogenytarbogginshypnagoguebranglingsgingeradesnightgearssignalingsgraddaningterengganutanglinglyzugzwangedbedagglingflag-wavingdanglinglyanglifyingspongebagsinveaglinggnashinglygrannieinggammockingspranglinggarlandageagnoiologygammoningsgeocachingologoaningremigatingdugongidaetabogganedgroaninglyslanginglychangjianggraecising
Phrases (74)
genus vignagenu valgumget-up-and-gosignal flaghanging flygenus fagusgenus agavestrong galegas fittinggenus tsugaflag signalhigh germangenus glauxgarbage canpango pangogarbage manget the hanggeorge sandget weavinggenus griaswhaling gunicing sugarright alongright anglegenus kogiaegg candlerginger snappiping guanegg-and-darthang glidergondang waxyi languageham and eggsgatling gungreen algaeblowing gasgarment baggauge bosondagger ferngenus agamagreen glandking orangehans geigergenus ajugaguinea goldfungus gnatliving wagesenegal gumgrind organhearing doggolden agergaming cardgain groundnageia nagiluggage vangeneva gownwiggle nailgenus trigagenus gadusgenus galaxgolden gategolden gramgo a long waychang jianggang ploughgenus gaviagenus tungagenus saigaevening baggebang palmangora goatgenus gereastrain gagegreg norman
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen