10-Letter Words Containing: D,E,H,I,K
(In Any Order)
There are 43 10 letter words,
7 10 letter phrases and
0 10 letter abbr's with
D,E,H,I,K in.
Best Scoring 10 Letter Words With: D,E,H,I,K
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| highjacked | 10 | 31 | verb, adjectivev, adj | |||||
noun • seizure of a vehicle in transit either to rob it or divert it to an alternate destination verb • take arbitrarily or by force | ||||||||
| hitchhiked | 10 | 26 | verb, adjectivev, adj | |||||
verb • travel by getting free rides from motorists | ||||||||
| chickweeds | 10 | 25 | nounn | |||||
noun • any of various plants of the genus Stellaria • any of various plants related to the common chickweed | ||||||||
| thickheads | 10 | 23 | nounn | |||||
noun • Australian and southeastern Asian birds with a melodious whistling call | ||||||||
| handpicked | 10 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kerchiefed | 10 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| doohickeys | 10 | 23 | nounn | |||||
noun • something unspecified whose name is either forgotten or not known | ||||||||
| bakshished | 10 | 23 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sheikhdoms | 10 | 23 | nounn | |||||
noun • the domain ruled by a sheik | ||||||||
| hoodwinked | 10 | 22 | verbv | |||||
verb • influence by slyness • conceal one's true motives from especially by elaborately feigning good intentions so as to gain an end | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (43)
likelihoodhitchhikedthreadlikedoohickieschickweedsbeknightedthickheadshandpickedhoodwinkedhoodwinkerskylightedkerchiefedhandspikesskirmishedhighjackedchickadeesdoohickeysbakshishedorchidlikesheikhdomssidechecksshadowlikedisk-shapedhigh-backedjerkinheaddeckchairswhiskifiedhigh-neckedheadstickskyphosidaekhedivateskhediviateunknightedhack-driverinkholderswoodshrikeshieldlikekitchendomshieldrakewindshakesknightheaddark-hairedhygrodeiksPhrases (7)
strike hardflight deckjohn updikepiked whalehideki tojohit the decktojo hideki
