Dictionary Only:
Profanity Off:

10-Letter Words Containing: CHA

 (In Exact Order)
There are 386 10 letter words, 67 10 letter phrases and 0 10 letter abbr's with CHA in.

Best Scoring 10 Letter Words With: CHA

Expand?WordSave?LengthUsagePointsType
chiffchaff10
32 nounn
noun

• A small, common warbler, Phylloscopus collybita, with yellowish-green plumage that breeds throughout northern and temperate Europe and Asia.

• Any of several other species of the same genus.

• (onomatopoeic) The song of the chiffchaff.

mechanized10
27 adjectiveadj
adjective satellite

• equipped with machinery

• using vehicles

cockchafer10
26 nounn
noun

• any of various large European beetles destructive to vegetation as both larvae and adult

mechanizes10
26 verbv
verb

• equip with armed and armored motor vehicles

• make monotonous; make automatic or routine

• make mechanical

quenchable10
26 adjectiveadj
Valid word for Scrabble US
mechanizer10
26 verb, nounv, n
Valid word for Scrabble US
chabazites10
26 nounn
noun

• a group of minerals of the zeolite family consisting of a hydrous silicate of calcium and aluminum

archaizing10
25 verb, adjectivev, adj
verb

• give an archaic appearance of character to

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

chatterbox10
24 nounn
noun

• orchid growing along streams or ponds of western North America having leafy stems and 1 greenish-brown and pinkish flower in the axil of each upper leaf

• an obnoxious and foolish and loquacious talker

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words With CHA In Order

Words (386)
chatteringwheelchairmechanicaldischargedchallengedchancellorcharitablechallengerchandelierenchantingexchangingcarmichaelcharlestonrichardsonpurchasingleprechaunchardonnaychauvinistchatterboxchangeablechannelingoverchargecharminglynonchalantunchangingmeerschaumchalkboardrechargingmunchausenchauvinismchartreusedetachablemechanizedchangelingchautauquachangelessmechanisedbedchamberchannelledchairwomansaccharinechastisingchaperonedcrunchablemichaelmascharioteercharitablychalybeateescharoticchanceriesrepurchasechangeoversubchapterchannelizechargeablechampignoncockchafertrenchancychalcedonychapfallensaccharidechastenessdisenchantchasteningmechanismschamferingmerchantedseneschalschainwheelgearchangemischannelprechargedmonochasiapushchairschastisersinterchaincharbroilsdischargerrechauffeschatterersuncharmingchagriningcharladiesmechanistsunchastityshadchanimcharteringchandelledcharabancscharcoaledchatoyancyunchainingchaffererschargrillschagrinnedchameleonscharlatanschaussureschamoisingchairwomenchassepotscochairmendetachablysurchargeschanteusescharismatachauffeurschamferersarchaisticmechanizessearchableflowchartschampionedchartularypurchaserschancinesschastenersmultichainrechannelsswitchablechallengeschargehandenchainingchamberingcharivarischalcociteunchastestchainfallschaparejoscharmeusesexchangersarchaizerschampagnescharterersspleuchanswatchablesastrachanschairliftschamplevescochairingstochasticchancroidschapteringrechargerssurchargedbleachablechangeablychatoyanceorchardistchatelainechaetopodschalumeausenchantersoutchargesunchargingoutcharmedsaccharaseantechapelchamfrainschaparralscharmingerarchaizingchampaignschaperonescheechakosprechargeswingchairschairmanedcochairmanhighchairsmoschatelsquenchablebechalkingchalazionsischaemiasmunchablesplainchanttrochanterchannelersdischargesrepechageschattinesseucharisesmechanizerperitrichaschatchenschainsawedchawbaconsattachablearchangelsguacharoesmischargedbacchanalsrechangingbechancingchalcogenschandellescharacterschastitiesrecharterschabaziteschatoyantsunchairingchariotingentrechatschaplaincyunchastelyachalasiaschaparajoscharlottesexarchatessaccharifyarchaisingchamomilesmischancessolonchakschiffchaffmischargesstonechatsbacchantescochampionsubchasersbecharmingcharacterychatelainsdischargeerechartinghierarchalpolychaeteoutchargedsaccharinschafferingchaffinglychanukiahschauntresseparchatesparischanecharacidaeschalsteinmarchantiaacronychalchavenderspettichapswanchanciechechaquoschaprassischaseportsheptarchalcarchariassubchanterbacharachschakalakaschaenactismumchanceschalkinesskurdaitchachannelisetrenchardschannellerchargelessmareschalssaccharisechauffeusechapelgoersaccharizechaulmugrachambranlechaologieschauntriesanarhichasparischanscharadriusschappeingchainplatechavtasticmerchantrychamaeleonpolychasiawapenschawsaccharosechainworksguachamolemischanterstanchableavouchablechancelesschapstickschasmogamydeckchairschaenopsischassidismsurchargercachaemiaschallaningleprechawnorchardmanchalumeauxchanteclerenchargingmarischalschaudfroidencharmingmechaniserchalcidflypanachaeassaccharoiduncharnelsachaeniumschaologistarchaicismchalkstonedaisy-chainunmechanicarchaiserschapattiescharmoniumfeldscharsmischancedchamberpotpracharakssketchablewapinschawmishpachahchairbornechaplainrycharthousecheechalkoproseuchaesticharioneleocharisnitro-chalkchaptalisehoolachansmoucharabysubcharterisochasmicoligarchalchangjianghemachatuspolychaetatwo-channelchargeablydisenchainleuchaemiachain-smokeorchardmenchannukkahsaccharatechafferieschalybiteschambererschantinglymechanisespanchayatssaccharumsmanichaeanrochambeauchainbrakepetcharieswallchartschainshotschapelriescharosethschechakoesbacchanticpreachablewarchalkermonochamusarracachaschairboundchappessesheadchairsbucharestichaiselesschaptalizehygrochasychachalacachalkfaceschandlerlykadaitchasorchardingchaetodonschatteratilichanoseschaturbateunchancier
Phrases (67)
sedan chairchange formpost chaiseside chapelchange overcharm quarkfair chancechalcid flyscratch awlcatch a winkslim chancerichard iiiwitch alderrose chaferarctic charcharge cardbeach asterchance uponeames chaireven chancechase aftergenus charapitch applechain storei. a. richardswatch chainchapel hillloch achrayrichard roeyacht chaircolor chartarctic harecharge unitdisc harrowbeach chaireast chadicnaval chartpaper chainswiss chardgun chamberchain tongskahane chaipotty chairwest chadiclochaber axchard plantslide chartfelis chauspaper chasetake chargechain armorlady chapelwheel chartchalcis flydeath chairchamfer bitchari riversea chanteychang jiangcharles viigas chamberpilot charttouch-and-gochain emailchannel catchao phrayalaunch area
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen