Dictionary Only:
Profanity Off:

10-Letter Words Containing: C,L,E,R

 (In Any Order)
There are 1,625 10 letter words, 288 10 letter phrases and 0 10 letter abbr's with C,L,E,R in.

Best Scoring 10 Letter Words With: C,L,E,R

Expand?WordSave?LengthUsagePointsType
lumberjack10
27 nounn
noun

• a person who fells trees

• a short warm outer jacket

circumflex10
26 noun, adjectiven, adj
noun

• a diacritical mark (^) placed above a vowel in some languages to indicate a special phonetic quality

schmalzier10
26
Valid word for Scrabble US
crystalize10
24 verbv
verb

• make free from confusion or ambiguity; make clear

• cause to form crystals or assume crystalline form

• assume crystalline form; become crystallized

• cause to take on a definite and clear shape

civilizers10
24 nounn
Valid word for Scrabble US
catalyzers10
24 nounn
noun

• That which catalyzes.

• A catalytic converter.

jackrolled10
24 verbv
Valid word for Scrabble US
coleorhiza10
24 nounn
noun

• A sheath-like structure found in a monocotyledon plant seed that acts as a protective covering enclosing the radicle.

carbolized10
24 verb, adjectivev, adj
Valid word for Scrabble US
exercycles10
24
noun

• an exercise device resembling a stationary bike

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (1625)
incrediblecommercialincrediblyhelicoptercontrolledmotorcycleelectricalelectronicwheelchairreflectionscreenplayhystericalcelebratedrepublicancinderellachancellorcollateralrespectfulcounselloraccuratelyacceleratecharitablereschedulechallengerchandeliertheatricalturbulenceproclaimedcontrollerarticulatecarmichaelcharlestonbirthplacereflectingbrilliancediscreetlyceremonialblackberryrhetoricalorchestralgracefullyleprechaunhealthcaredisclosureindirectlyarcheologycollarboneverticallyprojectilerelocationcomparablepercolatorforcefullyreconciledchroniclesreluctanceflickeringreflectivecarbondalebricklayervernacularcarelesslycornflakescreativelyrecklesslyclevernesslumberjacktesticularcirculatedcalibratedlubricatedparaplegicturtlenecklacerationresiliencecheerfullypercentilegloucesternarcolepsycantileverneurologicreciprocallinebackerdreadlocksaccelerantwildcatterrecoillessforecastleperiodicalprocedurallachrymoseheroicallydisclaimerdiscretelycerebellumrelocatingfreelancerforeclosedlancashirearchetypalcenterfoldflorescentturtlebackconverselycolourlesslandscapermercifullyundeclaredreceptaclefootlockerblackwatertabernaclereelectionbertoluccicerebellarbootlickerencirclingspeculatorprincipledilliteracysubculturereplicatedunculturedchroniclerrecyclablemercantilecandelabraelectoratecumberlandcornflowerheraclituscloisteredlacklustertriplicatevermicellidielectricturnbucklecardholdernecropoliswatercolorsilverbackconcretelycredentialejaculatorcorrelatederoticallygranduncleprevalenceescadrilleunmercifulcordillerapeculiarlysculptressperceptuallaceratingcenterlinepectoralishammerlockcarmagnolecraquelurecollieriesflycatcherectodermalfreelancedcrunchablecardplayerparticiplealtarpiecetelecasterclusteringcomplainerblackbeardinterlacedcreditableresiliencynecrophileeveryplacehyperbolicmetacarpalcoherentlywretchedlycentrefoldunscramblecaballerossecularismramshacklereceivableperchloricreplicablecensorableaccordablelacklustrescreenlandtuberculinrebalancedtricoloredcontritelybarcarollepremedicalclypeiformcaramelizecentralizetocopherolcataloguerulceratingbarleycorngermicidalchrysolitesecularistvallecularpreglacialleechcraftsilkscreenorthoclaselawrenciumfrolicsomepitcherfulprecludingcheliceraeclockmakercollarlesssemicirclecerebrallyblackheartmalefactorterryclothvolumetriccrawlspacedeceleratereallocatepreciouslyrecordableungracefulunderclasscloverleafcitronellachlorinateclodhopperpercolatedchristliketubercularcorpulencecrepusculeradicalizesubnuclearpluperfectcoercivelychargeableprincelingtrancelikelenticularsculpturedinfluencercavalierlyulcerationulcerativecalenderedreticulatepiercinglyorbiculateeffloresceturbulencyrefulgenceapiculturecentilitertruculencetruculencyvictuallersacerdotalcelebratorascribablephylacterycamelopardlockkeeperclawhammerbellyachersepulchralcreaselessdefalcatorclinometerluxuriancevermicularcalciferoleremiticalprocurablesecularizecradlesongchloraminechimericalcrystalizeacetabularpolychromeparcellingaldermanicalphamericdecolorizecranesbilloperculatecensurablecrepusclessepulcherscyclometercorselettecivilizerssepulchrescalibratessarcolemmaconeflowersclerosingbarcarolesunicameralschedulersclepsydrasdecontrolsreplicatescabrioletscordlessesopercularsoperculumsdecorouslypercolatesbracteoleslatecomersfortalicescaravellescrenelatedsacrilegesreclaimingcharladiesinterlacesmicromolescatalyzersdecouplersridiculersreclaspinglacqueringscribblersallometrichermeticaltolerancesensorceledacrylamidenecropolesensorcellsrebalancescompellerssupercleangridlockeduncluttershillcrestsreclosablesupercoilsrecitalistreluctancyafflicterspelycosaurclatteringreluctatesdeclaimersreclusionsluciferousreconsoledcamerlengococksurelyproclaimerclassifierreclassifycurtailersdiscoloredporcelainsinterlocalcolonizersprelectingprelectionsurcinglesprelectorslarcenistsinterlocksclutteringconcluderscrocodilesnormalciesclambererscalamarieslicensureslucubratedflagrancesconferralscurtilagescloistresscorrigiblecrewelworkparacletesaccursedlymicroclinereschooledcarrouselsfactorablealtercatedlaticifersaltercatesolecranonsprelocatesfluorescedfrolickersreticulumschildcarespreselectsfluorescerclavieristmicropylesdisplacersventriclesrelaunchedstencilersglyceridesrelaunchesexplicatorchronicledcherublikerepellencyresplicinginvolucresstockpilermicroscalemiscoloredpolitickerhousecarlsflorigeniccoculturedrecollectsresculptedoverscalederadicablecelebrantsallostericcelebratesdeceleronsgraticulesrecolonizeprechilledexcelsiorsrecoloringcurativelycheerleadssculpturesredolencescartilagestelemetricresectableinclosureselectrodesenclosuresbranchletsconcealersrecoupableconsultersrechannelschevaliersdecoloringsectorialsbecrawlingpredicablerecouplingneglectersrelevancesbroadscaleclearancesinscrolledlarvicidesjackrolledcrenelatesneglectorsbricolagesdecolouredrelicensedrelicensessearchablealacritiesrelictionselectroingreselectedsuperclassoverclaimsanchorlessproduciblemacroscalefreelancesacquirablecaterwaulscraterlikeliteraciespaperclipsacclaimerscirculatesrevictualscaracolersovercleansuncouplerspreclearedrecompiledcalendaredvaricellasbuckleringinflicterscharcoaledcrinolinescounselorsschnorkelscathedralsgarlickierclowneriesdecilitersscrubbableuncrippledcavalrymendeflectorselucidatorscoundrelssacralizedsacralizesreconcilescatalogersuncrumpleduncrumplescopolymersprotocoledsubcentralracializedhypergolicsourcelessracializesmillicuriesepulchredpreelectedbacksliderasphericalarsenicalsreescalatechondrulessucralosesrectanglesreplicasesclepsydraesclerotialscrewballsinterclassscleroticsclabberingcrescivelyplicaturesclerestorysclerotinsacromegalylocutoriespericyclescancellerspericyclicrecanalizecoleorhizarecladdingpeculatorscockleburscoelenteratheurgicalrefluencestreacliestovercooledreclaimerssuperslickclitoridesmiscallersclitorisessalesclerkpratincoleclericallyplacodermscrenulatedcongealersoverfacileprinceletsrectoceleslacquererscoromandelflackeriesprincelierlubricatestrickliestrelocateescamelhairspreethicalcarefullermetricallycircumflexcaliperingrecleaningpurulencescladoceransubclustervaricoceleprevocaliccorpulencycharlottesmercurialsrecappableresorcinolmenarchealclerkliestclobberingcereclothschannelerscarbazolessuperclubscarpoolersirenicallyretractilecorelatingcajoleriesdisclosersblockadersclerkshipsoverbleachcenterlesstricolettetrucklinesclathratesprecoolingreacclaimsvirulencesscrabblersprinciplesscrabbliernucleatorsreclothingclatterersdecrepitlyreluctatedcakewalkercylinderedluciferasecoproliteschurchlessluciferinsoctahedralgrapholectblackenerschurchliersimulacresslipcoversreconsolesprecalculiarecolinesrecatalogsrelacquerslinecasterdeclarantseldercarescarpellarycarbolizedcarpellateaviculturecarbolizesscragglierpreschoolsheptachlorscallopersstericallyprecancelsberascaledextricablesupercoolsvictualersconfederalcymbaleerscreaturelycurtalaxessurcingledlacustrinecatcallersscramblerscalamanderauriculatecalliperedoutcrawledreconsultsparbuckledclamberingparbuckleslucubratesnonnuclearinsecurelytrabeculaecentralisetrabeculastriticaleskilocuriescaramelisecentralismcentralistradicalisetelecoursecolorbreedpincerlikecentralitycasserolescotterlesscarbonlesscentralestfeldschersflichteredbrickfieldcherrylikeprelocatedfalconriesprelogicalpetrologicreactivelycurveballsfloricanesreconcilerreelectingpreplacingkiloparsecworkplacesfluorescesglyceridicsalureticspleochroiccompletersstencilleramerciableventriculicourtliestprickliestcervelasesglycerinesliquoricesplyometricedulcoratecarbunclesceilometercorpusclessplotchierbacterialstracheolarretinaculatracheoleserectilitycoculturesmycofloraebeclamoredcollectorshectolitersculleriescolorizerscartelisedmarcellerscartelisesmarcellingvorticellaapplecartstentacularforeclosesclangoureddecemviralherbicidalovercalledcartelizedcartelizesarchangelscentriolesceleritiescullenderslogorrheiccloudberrychisellerslectionaryenterocoelfreckliestschlockiertrabecularrecountalspreclusionlocalizerspreclusivecorrelatescitrullinetremoliticsuperflackuricotelicbranchlinecellarageslysimetriccornelianscalcareousbecquerelscorrelatorcheveluresschlumpiermacromolespronuclearcellaretteslackenersepicardialcrabapplesbolometricafterclapshomocercalincurableslowercasedoligomericschmalzierlowercasescellarwayshierarchalrocambolescolorectalscrawliestexercyclesherculeseschivalriesseculariseorchidlikeepicentralcarneliansoverchillsabacterialdeclarableallergeniccampestralcoulometernoncentralgerfalconsbrocatellecornfieldspraelectedcrenellingpeduncularsearchlesscorallinessocializerelectrojetultracleancopyholdercoulometrysecularitycoleopterahydrocelesenscrolledescaladersviscerallyclinkeringlockmakersparflechesclearweedssaltcellarcraterletsprecleanedclearwingscolportagecreditablyinflectorscolporteurcarbuncledcoveralledchrysotilecaracolledcartwheelsneurocoelsescalatorsclearstorycreolisingescalatoryvulcanizercrumbliestoverclearsrecompilesdulcimoresversicularbacklashertracklayercrinkliestclarifiersovercloudscreolizingcrackliestspectrallyultrafichecorbeillesdoctorlessracewalkedpencillersracewalkerlaserdiscscorrodiblecrinolinedslickenerscorbelingscorbellingclarionetscoverslipsmulticuriecablegramssquelcherspreslicingchloracnesscreenabletrochlearsunderclaysretacklingcalenderersquelchierpercalinescliometriccorbiculaesuperscaleovercolorsexclaimerschloraloselacerativeleadscrewscavalieredscreenfulsmicroliterrockslidesrecirclingsaucerlikenoncoloredslicksterscalenturesbronchiolereflectorsspecularlydecilitresexclosuresprecollegepronucleuschlordanesflarebacksrefractilecrumpliestchlorellascolumellarcordellingvocalizerscoralbellsundercoolscarnallitecoralberrycurlpapersbranchlesscheliceraldecaliterselucubrateclofibratesubcellarssuperblockunclearestfireplacedforelockedfireplacesmicrolucesscleromatarecallablereticentlysclerotiummicroluxespyrolaceaelycoperdonpericlineschloridisesclerotomycoalminersunclericalrecallmentcalibratercanceleerscanoodlerschloridizecyclometryterricoleslumpsuckerleucodermacardcastlecolubridaerecalmentscleopatraseriocaulonrubicellesnecrolatercancelierslipochrometurcopolesrectangledsclerotalsnecrologicpectorallytrinuclearrecanalisedrecksillstraduciblehalicoeresglucophorepubcrawlertularaemicpericulouscoleoptersdecinormaluncurbablearcologiesprofluencereplicatorintercludecraigflukepercolablesclerotisebichlorideandroecialparacelsuschlorinisebreechlesscerealistsclergiablereclaimantsilver-laceesclandrescensurablyclergyablecockleertsuncloistercarvedilolcatalyserscerebellicjerfalconscoweringlyranshacklechandlerlychlorinizeshauchlierfreneticalchristlesscrenellatesclerotizeclitteringcochleariaarctophilegreat-unclebicolouredrefulgencysarcostyleschnorchelnecrophilscrapulencecreole-fishiconolaterclericatesnecrophilyscaldberryhelicterescordylinesstarchlessflackeringstarchlikeprincelikeclubmasterscribbliergirdlecakerectorialsresorcinalrelocatorslaverockedforinsecalgrallochedscarletingchlorodyneclerkessesclubrushescordylidaereclimbingnuclearisechapelgoerprincesslystarchedlyreclinabledecreeablerectricialscrew-loosemenarchialflypitcherscaleboardsollickersnuclearizeclerklingscorelationpolemarchsgoalkickerhibernaclecontrouledcurselariecentilitrecorelativepericallisorchidalesprelaticalprocessualcleromancycalyptrateflyscreensdun-coloredchannellerstercolithcleruchialcleruchiascleruchiesflatscreencouragefultervalencytrisulcatescaleworkscreationaldry-cleanedhalobacterictericalscliff-brakescriggliercranefliesdeprecablepelargonicunprincelycheckclerkpolychrestchylodermaclosed-dooralcaiceriacamerlingocarbolisedcorporalescrewelistscylindriteovernicelyclamatorescarbolisestelecameraunicentralcockle-burrcoloniserscorydalinecrewellerycudgellersdilaceratearaliaceaecalliaturecrewellingclosed-ringcockleburrdeclaratorcefadroxilzelatricescapreolatecarfuffledchanteclercorylopsesrecurelesscarfufflesclaircolledeclaredlytelechiricalcatrasesagrodolcesrevolvencylandforcesprocoelouslactometernavicularecalabresespalmcorderplecopteratricyclerscryocablesauricularevermicidalincreatelycheralitesunscrupledprelexicalsexlocularcollarettelardaceousleprechawncaprifolesscuddalerssurculusesladder-backcheckrailshirschfeldvermiculesalcheringacloisterercorivalledendermicalurceolusesuncerebralbackvelderparcelwisereactionalholostericchoreologycoloraturegreenclothreticellasneedlecordheptarchalsocdolagereradicablyexulceratecelebratercasseroleddeclinatorsocdoligercreditlesstocherlesstuberculespalaestriccarillonedsternalgicfeldscharssocdologerrecyclatesunforcefulenranckledreticularyelectoressenrancklesbrickelliawarchalkercaprylatestorricellilocker-roomforeslackselectorialtrajectilecreakinglyrecyclistscamoufleurplacodermikilometriccrokinoleshermiticallockmasterpellicularpreceptialrepellancechapelriescobblerieseuchlorinemycosterolcherubicalclamourersedulcorantcourtierlyeuchlorinsalternancerepellancypreachablecalaveriteventriculepromyceliacarrytaleschildermastruncatelytuberculumculbertsonrepellencecentrelineclamperingdeclutterscoloriserstracheidalcherimollacurly-headssceliphronglycerogelelectrisedoricalchesleaf-cuttercreepinglyaerophilicelectrisesendocarpalhalterneckcompletorytrachelatelaparoceleuncharnelssceloporusoleraceousulcerouslymacrocyclecorpusculeelectrizedreceptiblesapropeliccruciatelyelectrizesunmetricalhectolitrehorseclothdratchellsradiculoserecoloniserupicolineunforcedlyoverclotheunforcibleferniticlecarbolateddichloridecartelismsschleppersschleppiermetrologicmicrosleepfetterlockcartelistsferntickleforeclothsacervatelycalorifiercheeringlylocalisersdecollatorhorseleechcentroidalnecrolatrycankeredlyenterocelefernticlednecrolysisworldscalefernticleschoroplethclimaturesillecebrumtrivalencefraterculafernyticlearvicolinetrivalencyencloistermerlucciuscodetalkerpleurocarpschlockerslovestruckburleycuescarmelitesleiotrichyfrecklingslectoratescorncockletricameraldecoloranttoo-carefullectorshipalopecurusrascaillescolourabledecoloratecircensialtectricialscrobiculebranchlikecarnalisedclapbreadslectressesseraphicalsubarticleneotericaloverlaunchphrensicalcarnalisesagaricalesuncheerfuloverplacedhierodulicendocrinalclapometerlaeotropicsculpturercalcsintercalceiformcannelurescarnalizedcarnalizesclapperboydeschoolercellaristsupper-classsceleratesoverglanceproctocelesocialiserchordeilesscorelineschoultriesclearcoledcolourisedenforcedlyclover-rootscrollableclearcolesclotteringcolourisesdescrambleelectrogenalectryonseleocharisexotericalcicatriclescheffleraencolouredpraecocialclapperingmareschalsbadderlockprecordialscrollwisetierceletsembryulciafebriculasincurrablesalimetricfebriculesperisarcalcartophilechambranlecirculablecolourizedlythraceaepleromaticcrotalidaecolourizesuninuclearchlamyderacholericlyfroelichiapolyhedriczooculturecomplotteralgometricutriculatesuccorableoutplacershierologiccringelinghieraticalclarabellacorallitesclearskinsricinoleiccraterlesssuccorlesslibocedrusfleckeringcalefactoroligureticproductiledicranalescephalagraarcellidaeclarendonspubliciservulcaniserlettercardclaribellaneurocoelearchilowescalembourscurfuffledversicolorracemoselyrecreantlypublicizercurfufflesrejectablesclaunderscorylaceaehatchellerracemouslycalendarercalocedrusvaricellarcrystalisepeelgarlicsermonicalcaperinglycochlearesstrickenlybeltcourseclinometryculturableacarpelouscloakmakerrejectiblesubcaliberovercloyedhyperdulichalf-crazedsubcalibreprecocialssclereidescrinolettefieldcraftreflectersintercalarelectromeruncolouredoverlockedholarchiescaramboledencradlingoverlockercarambolesmaculatureamerceablenephralgiccategorialcontraplexpleuriticspaleacritacorrosibletelerecordprolicidesimparlancescleriasessuccursaleundercliffscleriasisculvertagelarge-scalevulpecularunheroicalscleredemasucralfatelower-classovercolourbescrawledeolotropiccrippledomkeratocelecapillairerouncevalsprevalencyrejoicefulcalendrerscalendrieslacertiansgaleocerdoencrinitalunderclubsvocaliserscalypterascaramelledsaucerfulssclerodermhylocereusdecolorisesaucerlessshellackercradlewalksprauchledmicrolitesdecahedralxylochromechargeablyclartheadssprauchlesuncredibleproselyticbescribblerecalescedpendiclersscreenlikeforslackedblue-collarhyperfocalchargelessleafcutterunrecalledgoldcrestsrecalescescaromelledsacralisedlauraceoussacraliseshexaplaricsterculiascumberlesswater-colorcalfdozersprovocableracialisedclipshearscordialisemesmericaltelescreenlacertidaetroctoliteleucorrheaacroterialchristellaracialisesrecruitalsscaffolderchloridatecivilisersdecalitreslacertiliapericlasespierceablecrepolinescoalmastercrossfieldpericlinalcordialize
Phrases (288)
cover platechurch bellair cleanerline backercrown jewelscreech owlsilver cordsales forceslack waterd. h. lawrencecenter lineedible cornearth coloremery clothcarpal boneoscar wildeatlas cedarsmart aleckterry clotherotic lovemetal screwscarlet oakmusic loverforce fieldsoccer ballmajor scaleclot bustershoe collarhurdle racesecret planleaf scorchbeggar liceheroic talecargo linerkarel capekankle bracefer-de-lancelitchi treeres publicalabor forcefrench loaftrolley caractor's linegrace kellye. l. doctorowopera cloakletter casecarl czernycole porterwine coolerprice levelcarl rogersclub memberchorus lineparcel postprison cellocean linermuster callbottle corkcorbel archcover glasscorbel steppanel truckused-car lotcivil ordercoffee rollpearl s. buckslide chartkiller cellcalf's liversilver cityracket clubcali carteldirect loandirect mailroot celeryroot cellarrenal colicminor scaled'oyly carteslight carecereal bowlgolf courseclose ordereton collardry cleanerglance oversun blockercordon bleulever scalelittle rockcow parsleyhotel clerklung cancerlaunch areacafe royalecore blowercost ledgerpelvic archvital forcetruckle bedwelsh corgigrey jackalhog choleradance flooregg candlertower blockmale orchiscruel plantpolice workhair curlerdental caremoral forcefallen archtreble clefcress plantcat's cradlenoel cowardschool termscarlet cupschool yearcancer cellscarlet hawroble beechwheel chartt. e. lawrencelemur cattamiracle manmother cellcrawl spacelochaber axhour circlechrome alumclan membercontrol keyrush candlepower cableblack breadcattle farmblack breamcattle gridslit trenchcall centernuclear rnacall centrecaramel buncarpet loomfolk dancercamel's hairpedal curverauli beechlock washerblind curvesacral veinill servicetally clerkcareer girlforced salescrub planecoin silverrice weevilcall numberriver clydecelery pinewater clockcelery rootcoal cuttertile cuttercelery saltcelery seedrich peopleblack eldersupper clubvon bluchercamera lensclaw hammerprep schoolhealth careoil furnaceroman a clefcorn cocklest. lawrenceleg curlinglens cortexin the lurchaerosol cancorn glutenfrench bluecabin linerrock gunnelhelper celllocus nigercrab nebulacolor forcepurple lococherry plumcloud covermusk cloverr. j. mitchelllocust treecurrer bellcable radioclark gablecold cerealneural archfloor coverfrench heelcell theoryback circlecolor wheellight creamray cattellblack mairecold rubberkarl czernyerect buglehaemal archlaw officerheart blockalcea roseacold turkeyjack ladderblack morelclover fernmonte carlokrebs cyclee. o. lawrencemelic verseallen screworal cancerknob celerylancet archwitch alderroyal bracetarget cellbolt cutterbowl cutteruncle remusliberty capprice floorblue orchidwine cellarbaron clivelarge civetcredit linerocket fuelblack racerbush clovermark clarkeice crystalslug cuttercrystal setrectal veinwall rocketcrystal teawild celeryyellow racewild cherrylawyer canedrug cartelscrap metalcolour lineparcel bombleopard catsalad creambranch linecolour tubefiscal yearbilevel carlower courtmyrica galerecall doseclock towerocean floorethnic slurtrade cyclecharles viiconic morelcoral snakecrane's billlip servicemarble cakecard playercollar cellrobert curlholy cloverseckel pearclog dancer
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen