Dictionary Only:
Profanity Off:

10-Letter Words Containing: C,H,A,N,I

 (In Any Order)
There are 548 10 letter words, 55 10 letter phrases and 0 10 letter abbr's with C,H,A,N,I in.

Best Scoring 10 Letter Words With: C,H,A,N,I

Expand?WordSave?LengthUsagePointsType
chimpanzee10
28 nounn
noun

• intelligent somewhat arboreal ape of equatorial African forests

mechanized10
27 adjectiveadj
adjective satellite

• equipped with machinery

• using vehicles

chinquapin10
26 nounn
noun

• shrubby tree closely related to the Allegheny chinkapin but with larger leaves; southern midwestern United States

• shrubby chestnut tree of southeastern United States having small edible nuts

• small nut of either of two small chestnut trees of the southern United States; resembles a hazelnut

mechanizes10
26 verbv
verb

• equip with armed and armored motor vehicles

• make monotonous; make automatic or routine

• make mechanical

jinricksha10
26 nounn
noun

• A two-wheeled carriage pulled along by a person.

antihijack10
26 noun, adjectiven, adj
Valid word for Scrabble US
mechanizer10
26 verb, nounv, n
Valid word for Scrabble US
pickthanks10
25 verb, noun, adjectivev, n, adj
Valid word for Scrabble US
archaizing10
25 verb, adjectivev, adj
verb

• give an archaic appearance of character to

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (548)
chatteringmechanicalscratchingtechniciangrandchildchandelierenchantingexchanginganestheticantichristrichardsonchimpanzeepurchasingcunninghammanchurianchauvinistscathinglychannelingchinchillacharminglyunchanginglancashirechinquapinnudibranchrechargingcornishmanchauvinismhumanisticdictaphonechiffonademechanizedcorinthianchangelingmonarchistbrainchildmaraschinoanthracitecephalexinfianchettomechanisedchairwomanethnicallyhandicraftmackintoshsaccharinechastisingchilblainshypnagogicschliemannphoenicianfranchisedpathogenicbalanchinechanceriesanharmonicprognathicdeaconshipunathleticcrashinglychiromancyrockinghamchlorinatechannelizechampignonmachinatorchasteninginchoativeantitheticinharmonicdisenchantanchoriticsplanchnicbatrachiananaglyphicdiachronicchloramineanamorphicchancinessshowcasingchagriningchagrinnedselachianschinwaggedhypermanicreteachingchainwheelmachinatedhacksawinggynarchieschairwomenmischannelphantasmicmachinistschieftainspatchinessrepatchingcharteringenchaininghandpickedunchaininganarchistspitchwomanenchiridiahindrancesuncharmingmechanismsmonochasiamechanistssandwichedmechanizessandwichesshanachiesunchastityraunchiestantichoiceunlatchinghesitancesbranchiestbaldachinobaldachinsmegaphonicstanchionscachinnateanchoritesmonarchialmonarchieschamferingcochairmenbackhoeingshadchanimmultichainhatchelingstomachingchamoisinghatchlingscheloniansarachnoidsachinessescathepsinspicayunishchinawareschampionedchincapinsunachievedinterchainratchetingtheophanicfranchisernaphthenicnonethicalfranchiseschinkapinsunactorishfranchisorsennachiesescheatingchariotingharmonicaschafferingechinaceaschromaffinhaciendadochancroidsendotheciasnatchiestthatchingsheliconiaschinstrapschromatinsnaumachiaenaumachiasnaumachiescheapeningimpeachingchionodoxachainfallsachondritecohabitantanarchicalphonematicchainsawedallophonicepicanthusphysicianscohabitingjinrickshacharmingerendarchiesrevanchismchaplaincyhackneyingrevanchistcatholiconconchoidalmachinablecashieringmachinateschairmanedcandlefishcashpointschatelainemischancesclaughtingpickthankshaloclinesinchoatelyscraichingtechnicalsmonarchismscraighingcarhoppingcohobatinganorthiticchalazionsantiheroicdichondrasantihijackphonicallydebauchingunchairinganarchismsmyasthenictaphonomicisochronalclannishlybechalkingenchiladashawfinchesbechancingchronaxiesunchargingaitchbonesbecharminghemocyaninmechanizerphenacetinenharmonicneophiliacarchaisinganachronichypomanicspaunchiestunteachingarchaizingrematchingantichlorsplainchantcatarrhineshankpiecearchegoniaantichurchrechangingmanchineelantechoirsrancheriaschatelainsmonachismsbranchlinesaccharinschapteringraincheckscartoonishrechartingchamberingsaxophonicschmearingantishockstrauchlingchattinessunemphaticchivariingeuthanasicarchfiendscochairingmorphactincochairmannomarchieshoactzineschamfrainsphenacainecochampionphenacitescochinealsantheliceshurricaneschelationscraunchinghopsackingcathectingchampaignswingchairsthylacinesupreachingstaunchingfranchiseehematinicschinaberrydinarchieslichenaleschristianschannelisecanophiliacenotaphicacheronianacherontiapentastichchelonidaerhaponticscanophobiachicaningsacheronticharmoniconantipathicchaffinglyamphisciangrassfinchmarchantiaanhidroticanthriscusdisanchorssnatchingsouananicheshauchlingsplatchinganthracoidmiscanthuschainbrakematachinasantiphonicrhyniaceaecataphonicchainplategosan-chikugenethliaciconomachyepicanthicchain-smokestrychniasscherzandiappeachingmenarchialstracchinichainshotsstracchinopuschkiniaschiavonesanarhichashackneyismhibernaclebraunchingachromatinchainworkscharmoniumcheatinglychairbornechairboundtibouchinamonomachiacantharidschutzpanikencephalichigh-octaneachromycinnavarchiesencephalinphoneticalpeacherinomachinegunhandicuffsclauchtingwapinschawmachinemanmischancedpeachinessscrimshankmachinemenorthocainehistaminicrecatchingcasingheadmachiningsechinoideafrancophilphantasticmischanterarithmancyhymnodicalinchoatingcynophobiainchoationparochineschantinglyascolichenbleachingsalcheringasinarchismchanukiahssinarchistmantichoraunmechanicmonophasicenchargingauthigenichousatonicencharmingmaconochieditrocheanhyaluroniccatchinesslichanosesscranchinganarchisedanarchisesdisenchainunpatheticbacchanticflaunchinganarchizedunchancieranarchizesthylacinuscliffhangsheptatonicchippewyandibranchiamechanisergleicheniaharmonicalmechaniseschalkinesscynophiliachiromancechaplainrycoachlinespreachingschallaningcalaminthaphrenesiacanchylosischiliagonsorchardinghaemoconiarhinothecaparonychiahyponasticcarthamineeichhorniachitarronechitarroniunthematichijackingsbranchingsshrinkpacknitro-chalkdaisy-chainbranchlikephrensicalrancheriesmonachistsnectar-richchittagongseannachiestanchingsabranchialscrauchinganachorismhexactinalscraughinghaematinicchilopodangraunchingdiachylonsthiocyanicparaphonichomorganicpoachinessacanthosisflanchingsnightclassacanthoticanchoreticrecheatingtachinidaelancetfishchevisancetheodiceanhalcyoniansynarchiesnartheciumhygienicalempeachingatchievingmonarchiseeuharmoniccrotaphioneuphonicalhieromancymonarchizeupcatchingachaeniumslithomancycacophoniccraunchieranchyloticchevrotainchiackingssticharionwanchanciehemicranianephralgicarachnidanhypocapniathwackingsunheroicalcarthusianhinderancechinachinafaulchionsmanichaeananthericumbranchiategeocachingacrophonicchaenactischauntriestheomaniacchinarootsnaphthalicphagedenicchaenopsisamphictyontheomanticlepechiniaschalsteinmakunouchicanachiteszincographfianchettiarchonshiphabitauncebranchiuraasthenopicparischaneclashinglychangjiangparischansnotaphilicschappeing
Phrases (55)
slim chancenicholas iianchor ringcane blightjohn calvinfair chancecatch a winknight watchnautch girlsedan chairgrass finchcanoe birchmatch pointair cushionmachine guncatherine ichain armorchain emailchain storechain tongswatch chainchinese yamwatch nightswan orchidwar machinemexican hatzebra finchbathing capswitch canecharge unitbirth canalcash in handgiant conchst. nicholasgiant perchsquare inchpaper chainchilean nutjohn ciardiwishing caplancet fishtachina flynight latchfinish coatchang jiangice machineshrink backbeacon hillbranch linekahane chaikate chopinchina asterchina grasschina stonehsuan chiao
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen