10-Letter Words Containing: C,A,E,S,A,R,S
(In Any Order)
There are 64 10 letter words,
3 10 letter phrases and
0 10 letter abbr's with
C,A,E,S,A,R,S in.
Best Scoring
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
jackassery | 10 | 26 | nounn | |||||
noun • The foolish or obnoxious behaviour of a jackass. | ||||||||
haversacks | 10 | 22 | nounn | |||||
noun • a bag carried by a strap on your back or shoulder | ||||||||
sacralizes | 10 | 21 | verbv | |||||
verb • To make sacred | ||||||||
scrapheaps | 10 | 19 | nounn | |||||
noun • an accumulation of refuse and discarded matter • pile of discarded metal | ||||||||
crankcases | 10 | 18 | nounn | |||||
noun • housing for a crankshaft | ||||||||
saccharase | 10 | 17 | nounn | |||||
noun • an enzyme that catalyzes the hydrolysis of sucrose into glucose and fructose | ||||||||
scrappages | 10 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
scareheads | 10 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
ransackers | 10 | 16 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
barbascoes | 10 | 16 | nounn | |||||
noun • West Indian shrub or small tree having leathery saponaceous leaves and extremely hard wood | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 10 Letter Words
Words (64)
scarabaeussacramentshaversacksjackasserysugarcanesaerospacesassurancescaesariansascertainssacralizesscareheadsarsenicalsstavesacreransackersstaircasespancreasessmearcasessaccharasebraincasescrankcasesscrapheapsscrappagesmarcasitessectarianscanvassersmassacrerscastratersascariasescaesareanscaesarismsescaladersescalatorsbarbascoesascorbatessarpanchesparacelsuscatalysersstaircasedcasemakersspacewardssaccharoseincrassatealcatrasescalabresescassareepsarcanenessanarchisescheatgrassarchaiserscesarevnasrascaillessarbacanescarnalisessaccharisemareschalsarabicisesscramaseaxcatharisesparascevessacralisedpraiseachssacralisesamaracusesracialisesPhrases (3)
isaac sternaccess roadbeach grass