Dictionary Only:
Profanity Off:

10-Letter Words Containing: A,N,N,E

 (In Any Order)
There are 1,530 10 letter words, 293 10 letter phrases and 0 10 letter abbr's with A,N,N,E in.

Best Scoring 10 Letter Words With: A,N,N,E

Expand?WordSave?LengthUsagePointsType
mezzanines10
30 nounn
noun

• first or lowest balcony

• intermediate floor just above the ground floor

johnnycake10
29 nounn
noun

• cornbread usually cooked pancake-style on a griddle (chiefly New England)

jonnycakes10
26 nounn
Valid word for Scrabble US
exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

cognizance10
24 nounn
noun

• having knowledge of

• range of what one can know or understand

• range or scope of what is perceived

channelize10
24 verbv
verb

• direct the course; determine the direction of travelling

• make a channel for; provide with a channel

• send from one person or place to another

• cause to form a channel

benzofuran10
24 noun, adjectiven, adj
noun

• a colorless oily compound extracted from coal tar and used in manufacturing synthetic resins

phenazines10
24 nounn
Valid word for Scrabble US
tyrannized10
23 verbv
verb

• rule a country as a tyrant

• rule or exercise power over (somebody) in a cruel and autocratic manner

zinfandels10
23 nounn
noun

• dry fruity red wine from California

• small black grape grown chiefly in California; transplanted from Europe

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (1530)
understandlieutenantgenerationunderneathmanagementengagementassignmenttournamentunpleasantincreasingadrenalinecopenhagenmeaningfulunderpantsmaintainedattendanceendangeredcontestanttechniciandisneylandmayonnaisephenomenalquarantinerenovationenglishmanabstinencenationwideafternoonsdescendantlaunderingenchantinginnovativeexchangingwonderlandgeneratingdetonationunattendedmonumentalannihilateinternallyrepentanceintolerantfingernailunansweredundeniablesanctionedconcealingindonesianunbalancedrenovatingpanhandlerconsensualinstalmentincendiaryunfastenedsecondhandintangiblesustenancevenezuelancongenitalmacedonianredundancyintestinalcopernicangovernancebanishmententrapmentembankmentvenerationalienationneapolitanincidentalornamentalunwaveringnauseatingchannelingincinerateundeniablyqueenslandpenmanshipunravelingpermanenceinfernallygentamicincancellingheadliningcondensatecannelloniabstentionmeningiomaroadrunnerdetonatingconfidantemanservantendearmentantagonizeunassignedhandmaidenuneasinessannexationalienatingrandomnessunfairnessmunchausenuntalentedinordinateunwinnableunknowablepreplannedinsinuatedresonatingcantonmentencampmentnanosecondsunderlandnewfangledchangelingcentennialhearteninghinterlandpolynesiantransgenicwindowpanehandednessshenaniganfontanellequaintnessbanquetingchannelledconcertinainseminatemainlanderhanoverianbroadeningpomeranianhootenannymeanderingincarnatedmenacinglydinnerwareconveyanceunsinkableunnameableretrainingastringentgranduncleascendancycognizancebelladonnaattainmentbannistersprovenanceantagonisedickensianunexaminedencasementslackeningunordainedsneakinessmelanesianpenalizingpennyroyalreengaginginvariancesemiannualschliemannmalcontentseminarianconnivancephoenicianpermanencytangentialmillennialdissonancejourneymanstonemasonparisiennecreatininewantonnessrepugnanceentrancingantecedentunmanneredblanketingpentagonaltransiencepentathlonbalanchinecontravenegingersnapserenadingnapoleonicdefensemanunleavenednecromancyconversantnonpaymentoceanfrontadamantinenonstarterscreenlandtenantlessunmaidenlyrepanelingnontaxablecountermantennesseanentrappingunanchoredunlamentedcandidnessconfessantinhumanelynominativeobstinanceenfiladingenunciatedunseasonedunlearningcovenantertanglementnonalignedelongatingunenviableevenhandedfountainedunreasonedblarneyingoceangoingblackeningamerindianabnegationelongationgrandniecerelearningdaintinessblancmangemarinelanddependancewinemakingpancreatinenvisagingcarcinogenveneratingchannelizecrankinessbarrennessnoblewomanunpregnantunbendablemaintainerrenunciantmountebankanticancerherniationunpleasingunhandsomemannerlessdetainmenthumanenessrefinancedbrigantineunmannerlyamanuensisnarrownesspteranodoncongregantgangrenousanglophoneenantiomerannunciategraininessscantinessentailmentantipodeanbenignancyenervatingenervationrenascenceascendanceanointmentascendencydenotationincessancyunstrainedengaginglychasteningarctangentbrawninessunbrancheddenudationinwardnessdisenchantbrazennessmendicancyyearninglynonliteralmonovalentornatenesscyanogenicuntenantedjauntinessobtainmenttrenchancyopenhandedmanfulnesspliantnesspensionarysanderlingstentorianhusbandmencondonablenaphthenesunburnablevenenatingantinukersnonrenewalbandoneonsincandescecaravannedchancinessensilagingpeneplainsevanescingemendationdenudatinganhedoniasnurturancesaunteringsmarteningnicknamerscoannexinghappeningsandrogynesresonanceschagrinnedunawakenedrepaintingunwarinessfinancierscongealinguncanceledantiveninsensnarlingsensationsdownfallenvengeancestenantriesdaringnessendamaginglentamenteitinerancylancinateditinerantslancinatesencashmentlineamentsmanhandledswankinesscoenactingmelanizingmeannessesevanishingspinnakersemalangenimendicantsengraftingpantalonesemanationsunamenableengrailinglineationsdenaturingreannexingendurancespeninsulasreanointedexaminantsjaveliningsapogeninsmaunderingmischannelengrainingappendantsunfindablecravennessinebriantsnonnativesenswathingnonaqueouscantilenasentreatingintegrandsenchainingperennatesintegrantsrenominateintactnessengravingsperennialsbayonetingcandescentpertainingexplainingpatterningbraininessdefendantsremanencesinterregnarepugnancyneonatallyinapparentcarbonnadealimentingnativenessnaissancesfasteningsrewakeningdenegationamnestyinglandownersolecranonsmavourneenunpedanticindexationtriennialssneakinglyhindrancesrefrainingpalankeensironhandedmonoplanesmainlinerscolonnadedsandstonesautobahnenargentinesmannequinsinclinablemannerismsnonparentsunspeakingnonpartiesvalentinestoenailingplangentlyinsanitiesisoantigenstrandlineenunciablenegationalenunciatesscavengingbengalinesdependantsneatnessesnontalkersenunciatorcanyoneersnegativingpanhandlesregrantingrechannelsantedatingsanguinelyfundamentsevanescentgladdeningbrigandinedeadpanneddeadpannerreasoningstangerinestetanizingreenactingcatenatingensanguinecachinnateattendingsentertainsunenlargedantennulesascendantscovenantedcovenanteeenactmentsdemandantsannelidansantependiaascendentshankeringsnegotiantspenalisingcannistersdefiniendacofinancesdeafeningscannonadedcannonadesimpanelingluminancesantimoniesascensionsinnervatesabandonersinterbasinsubtenancycannoneersreplanningunapparentnumeratingnonelasticenamellingamendmentsineleganceinnatenessemendatingoutearningordainmenttyrannisedexpansionstrepanningancientesttyrannisessnappinesstyrannizedunbandagedtyrannizesunbandagesantinausearawinsondedenaturantenamouringdentationsannotativedaunderingalmandineswanderingsannouncerscheloniansannoyancesordinancesengarlandsabundancesnonreactorcontainersnonveteranrealigningrenaturinginfluenzaldestaininguncleanestgarmentingannualizedadornmentsannualizesantinomiessharpeningamanuensesovermannedfaineancesandrogenicincarnatesnunciatureinterchainenwrappingdetrainingordonnancetranscendsinterurbannaphthenicnonethicalanamnesticinnumerateadrenalinssennachiesstagnancesannulmentstransiencymanganateszinfandelsbepaintingrancidnessmanganesesnurserymanrenegadingendosulfansanbenitosattornmentranknessesaventurinscaravannermanganitespeneplanesgangbangerpentatonicinfantriesnonmarketsanthraceneinterplantpenetranceunaffluentresonantlyuncalcinednonmedicalpenetrantskingsnakesphenomenasdenominategeminationcotangentsuraninitesrehandlingcheapeningtenantableunivalentsencephalonascendenceunopenableantivenomspurtenancemenadionesnemerteansinsinuatescoarseninguntreadingleannessespandanusesrecleaningtripinnateoutspannedundereateninsurancessententialnonfarmersuncanniestgreateningquinacrinenonsalablenonadmirerpermanentsnonfederalchannelersendplayingvenialnessjonnycakesgangreninghackneyingbethankingignorancesmanhandlesslanginesspetnapingsharnessingnervationsnonthermalprewarningnucleatingunmanliestpetnappinggynandriesnucleationentrainersentrainingalpenhornsswanneriestanzanitespreweaningantonymiesnonallelicherniatinginterzonalinsanenesspartneringinpatientsundecadentflatteninggalantinesattunementsexennialsanophelinequaternioncandlenutsnectarinesnonseptatenonanswerseglantinesantipyrineinearthingnonserialslevantinesinterloansmisplannedbienniallygannistersappendentsnongaseousjohnnycakebartendingcolonnadesbenchlandsfrangipaneuninitiateantianemianongenitalperennatedmelatoninsnonskatersinfestantsenchanterstransgenesatonementsomnirangeslanthanidegantletinginjectantsdefencemannonnuclearbenzocaineunswearingnonasceticbenzofuranalignmentsharsheningorganzinessententiaenonspeakernonathleteantihunterwarbonnetsentanglersinterlunarentanglingexplantingundulancesmalignanceinterrenalleaveningsmonoaminesnonstaplesnondancersalinementsbannerettespancelingdepaintinghandselingcontinuateprefinanceinductancepanellingsbechancingvainnessesbarkentinehardeningsalternantsremontantsresinatingunderhandscandlepinsestrangingnewsagentsnonlexicalduennashipintendancetransientsunaccentedassonancespanettoneshemocyanincaninitiessafraninesflavanonesintendantsreinvadingphenacetinreinvasionenharmonicundertakenguanidinesnondemandshearkeningcelandinesunhandiestnonpareilsunearthingsanenessestramontaneregnanciesguanosinesintenerateanklebonesnearnessesempanelingmanneristsenclaspingpangenesesgreensandspangenesisquadrenniapangeneticunteachingdeadeningsnonpassiveasyndetonsdominancespeninsularsubpenaingnondeviantdecennialsmentationsdescantingantecedingconventualpanhandleduninflatedvernationsdandelionsmonstrancerechangingimpregnantcannabisesmanchineelnoncabinetgeminatingenjambmentpoignancesbegroaningbranchlinecorneliansabnegatingnascenciesangiogenicinstanciesincunablespneumoniasdeadliningtangenciestetanisinginterabangreadorningimmanencesnewsstandsrefinancesenkephalindateliningderaigningtiemannitecrenationsnonplayersnoncarrierunleashingparentingsattendantscatenationimmanentlysnakeskinsawakeningscarneliansantennularantimoderncovenantalnoncentralmonandriesantepenultintragenicnepentheanattentionsunanalyzedaugmentingmargentingnondurableempennagesanticlinespregnantlynonearningcofinancedcovenantoroutplannedpraenomensnumerationpraenominaantimonidecatchpennyzaninessesseptennialinnervatedbehindhandphenacaineornamentednanometersmangosteensubtenantsnanometresleadennesscarnitinesflanneletsconsonancecannonriesnonclassesreplantingmandolinesinternodalmonogeneanunbalancesflannelingsignalmentflannelledhansellinganthelionsenlacementtrepannerscannulatedmezzaninesnovocainescannulatesnanoteslaslanknessesanagenesessenatoriantyrannizeranagenesisnonbearingmagnetronsphenazinesantinaturehoarseninginteroceanaventurineinnominatedanknessesinvaginateseasoningsgrenadinesgreenshankvacantnessinterorganrangelandscanonessesslanderinguncreatingnonreadersstannariesnonreadinginfluenzaslaundrymenpentanglesnonlawyersnonvintageungainlierpendragonsamantadinenalorphineintreatingnecklacingnaltrexoneantinovelsinnumeracyreentrancecanonizersreentrantsadenosineslanuginoseamarantinebandoleonsdinanderiefandanglessaffraninescandentiacosteaningnuncupatedonocentaurenarrationfandangoesnuncupatesannullablefarrandinedebonnairelanzknechtconnatureschannelisebandolinedunsafenessbandolinesacheronianspinacenesfainnessesintriganteriemannianaberdonianlengthsmanmenyanthesdiamantineencurtainsannuntiaterenegationdecandrianeburnationstephanionponderanceingeminatebienseanceponderancyanhelationinsulinasecaseinogentannenbergwassermannpinnulatedbetacyaninmangemangemanurancesdragonnadeunderdrainstonehandsdenunciateanhungeredouananichepenetrancyeminentialunobtaineddemicantonincasementtransennasunwantedlysangapenumunivalenceunwindablebemoaningsresonationsanctionerdisannexedanhingidaetenaillonsdisannexesunderdrawnunhumaniseunivalencyantiphonerenneagonalwanthrivennut-bearingcancionerolemanderinenneahedraunhumanizereamendinginterlakencentauriantenantshipsnazzinessnemertiansinsurancercognisancemelanisingnauseationenneastyleincoronateendangererwantonisednandrolonewantonisesunrentableunwearyingsingle-laneheaven-sentwhunstaneswantonizednevirapineconnotateduncanonisewantonizesskankinessconnotatesunfastenernaffnessestendentialunmanacledunmanaclessalientianentrailingpantaleonsblenniidaeuncanonizeengraffingnelfinavirhackneymananemonellaunfattenedpentosanesneandertalhackneymenunimaginedanamniotesanonaceousranitidinecincinnatemolendinarenstampingpandemonicunalteringchannellermanhunterssubmontaneevanitionsanonymisedanonymisesencephalinovernaminglanddamnednidamentalanonymizedlanddamnesmachinegunnidamentumcanavanineanandamideanonymizespythoninaeurbanenessperidiniansubnascentmachinemanundecagonsinpaymentsmachinemengenialnesslignocaineunicentralunpanelledbiannulatenarcotinesorganogenyengrainerspanthenolsknackeringshoshoneangannetriesendecagonsredundancenaifnessesunparentedunanalysedvanishmentbonnilasseknackinessthereanenthandlangeredmontoniavinegaringsunderanceantivenenepantherineunpaperingstarkeningneologiansunpatentedunprofanedtyrannidaeuncranniedarenationsnotonectaltownsendiaengraspingunmaternaloenomaniasuntuneableseminatinglantern-flyseminationgabapentinsavingnessknagginessgovernantepennaceousseacunniesunpardonedbonnetheadundreadingxenophanessovenancesundreamingengrenagespennalismsunparentalodd-pinnateunguentarypernancieszeaxanthinhugueniniaunmechaniccanyonsidehandphonesremandmentenchargingassentientratteningshirudineanunturnablecinerationencharmingpennatulaepennatulasprenanthesinquinatedarcanenessinquinatesnative-borningenerateconvenabledisenchainhinderlandsalanganesconvenanceenranckledundelayingcismontanebalneationscranniestenranckleshinderlanstrapannersaconitinesprenominalencheasonsinelegancycanescenceunchancieralineationbannerallsbarkantinecantonisedmalenginesenfacementenguardingxenomaniasinappetentcantonisesmalentenduanaximenesaccensionstenementalxenomeniasneonomiansgreenhandsgabionnadeservantingdepanneursnonstativenoumenallyun-americanwindfallencantonizedalternancecantonizesmaskanongecynghaneddmountainednewsagencyenraungingindignancenalbuphinelennoaceaepretendantmaskinongemalignmentmandeanisminequationintendancyplenilunarquarendensuncharnelsrepentantspennylandsinfinitatejuneatingscatanancheniffnaffedtennantiteadamanteanminelayingpink-orangemainpernorendocraniadenisationfilicineanuntangiblenabumetoneunarrangedenhearsingnacimientoazobenzenetakingnessunderagentenheartensantilopineneopilinaseliminantsrenunciatestand-aloneunascendeduncongealsnuisancersbanteringsintensatedfarandinesintensatesexsanguineconfinablecongenatornecromaniaplain-wovendenizationbaserunnerunindearedshankbonesdecennovaldependancyendodontaluninflamedferrandineconservantinurbanelylamentingskernmantelclanswomennitraminesneoteiniascircensiannew-fangledpinnatipedmeganewtonvanadiniteunforsakencannellininitratinestwo-channelcleansingsunatonablepinnipediaendocrinalcanzonettasynanthiesnosebandedseannachiecleanskinsskinnerianneurationsbranderingcanzonettegermannessneopolitancannelurescartonnagebannerlikecatenarianbarnburnerimmanentalendodontiastanchnesspensionnatdenotatingalabandineenvaultingunendearedrebrandinginexistantattendancyenablementantenatalsensamplinggardeningsendoneuriacellentanimandarinesantennariabundesbankjohannesessaint-saenssnakestoneflanconadeattendmentbestainingdisentrainkentuckianuninuclearentertakenunenslavedannealingsraveninglyabstinencynegociantsunentailedmnemonicalinterbrainpregnancessubtangentantimonatefatteningsunstanchedunanimatedencomiendagymnadeniaunenviablyunransomedanadyomeneattenuantsseptennateunwarenessnovenariesunannealedhenchwomanhootnannieclarendonsdemanningsnanogrammeflankeringvenationalunhearsingabandoneesmethanogenantimonitebatteningshexagynianrosanilinesnaphancespergunnahsunshakenlyamenaunceshendecagonsnaphaunceunheartingornamentermansonriesahvenanmaaterengganupenannularannexmentscannoniersantileptonundernamedinnerwearscontrahentunhardenedbesaintingmismannerspatientingcarageenansnapperingcrinoideantriaenodontyranniserphaelonionabondancesabonnementresnatronsinveaglingracerunnertentationsnominaliseandrenidaeencradlingunwateringnefazodoneraisonneurwanchanciearms-runnergrannieingphaenomenaannonaceaeunweakenedpandanalesnationlessnominalizeencreasinghinderancewaymentingdannebrogsunweaponedavanturineenlargeneddecagyniannominatelydynamogenymanichaeanregainmentlansquenetencrinitalengarrisondidanosineenragementcanonicatehexandrianpannikellsannualisedinfamoniseannualisesenantiosesconnascentenantiosispaintinesslanterningpropanonesparegmenoninfamonizecanonisersinventablelanternistunexpandedmillennianamianthineunisonancegainlinesseumelaninsuncleansedinhearsingcontangoedcornopeansstannotypeavengementretainmentcontangoesunderplantungarneredenwrapmentprevenancyleibnizianminnesotanorangenessunexactinghanded-down
Phrases (293)
genus inulanavel pointbrandy nosejohn napiergenus nasuagenus vignafall in linesecond handaniline dyeaniline oilman of meanssnake venomglans penisbone spavinminute handgenus manisround anglerattan canejohnny cakein name onlycanvas tentlantern jawedmund keanbad mannersedna o'briengrand tetoneast indianla fontainebase runnersend aroundhenry fondahuman beingtable linenwest indianbos bantengone and onlyguinea cornwindow paneankle jointian flemingindian hempbatten downdean martinsection manlean-to tentanne brontenail enamelcanis nigeranne sextonone-man rulefar and nearpenny grasskenzo tangeedwin h. landmental noteland tenurespinal veinhand-me-downhorace mannorange rindmaiden pinkpeanut vineocean linerjean racineannual ferncannon firesine qua nonchannel catonion bageljeanne d'arconion breadplant genusmutant genepearl oniontank enginetrade uniongenus irenamanila beangenus naiasgenus vandanewton's lawgenus najasstone plantpaul newmanin absentiajan van eyckbengal beanjane austenbengal kinonathan halebanana peelin any eventconan doylerunner beannerve agentbanana treenow and thenmachine gunlunate bonelake vanernpet scannergenus anserhoney glandsnake dancebenin francgenus vincasnake fencehoney plantin darknessman and wifebear down onnever againsabine pinehere and nowyankee cornbear in mindconjure mansnake plantlemna minorlung cancerstring beanventral finmanner namedemand loandemand notenew britaingenus nomiacanary winepiano tunerdining areapine martengarden pinkcat scannergenus mantaginger snapnew englandnear visionround dancenemean lionadonic linetennis balltennis campgenus lamnanew irelandtinned meatdinner pailgenus nyssareal tennisgenus ochnaagonic linelinear unitgenus sennairon maidenvienna rollnew mexicandanger lineamen cornerleading manbrown hyenadanger zonelife tenantnative landawning deckamino resinnew orleansnuclear rnalined snakewonder beanlinen paperbanian treenet curtainliner trainrue anemonesaint denisverbal nounnor'-nor'-eastanser anserjoint snakeblind snakea. e. kennellyhulsea nanadomain namegenus lemnaanise plantvon neumannstan the manhave in mindsunken archgenus tincagreen glandgenus tineaking orangecommon beantoe dancingindian beanindian beetskin cancergiant elandfranz klinefrench beangenus toonacyanine dyecabin linermoney plantgold pannernew zealandnote of handhadean aeongerman naziindian filegenus canisgenus cannastewing panferdinand ifinger scanmensal linechilean nutniger francgreen snakeindian mealferdinand vmarine mineremain downroad runnernageia nagiethan allentake in vaingeneva gownhappen uponindian pipeandaman seaindian pokechance upongenus alnusgenus funkaarc tangentteton rangesenna alataanne boleynplane angleindian ricehalf nelsongenus avenatwo-man tentcongo snakenews agencysand launcelawn tenniswine makinggenus panaxnight ravenbanyan treegolden meannight snakevenae renisrace runnereven chancegenus tungagenus lonasgolden raincanned foodjean cauvinsea anemonekidney beannoun phrasecanned huntinner rasoncanned meatterm infantbranch linecannel coalevening bagsense organspent grainmaiden auntpinus pineamaiden namelanding netjean monnetgenus lundawinged beangenus anasacannon boneheat enginearchean eonuneven barsulnar nervegenus usneaten-day fernchina stonepreen glandgreg normandonner pass
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen