Dictionary Only:
Profanity Off:

10-Letter Words Containing: A,N,I,C,H,E

 (In Any Order)
There are 292 10 letter words, 27 10 letter phrases and 0 10 letter abbr's with A,N,I,C,H,E in.

Best Scoring 10 Letter Words With: A,N,I,C,H,E

Expand?WordSave?LengthUsagePointsType
chimpanzee10
28 nounn
noun

• intelligent somewhat arboreal ape of equatorial African forests

mechanized10
27 adjectiveadj
adjective satellite

• equipped with machinery

• using vehicles

mechanizes10
26 verbv
verb

• equip with armed and armored motor vehicles

• make monotonous; make automatic or routine

• make mechanical

mechanizer10
26 verb, nounv, n
Valid word for Scrabble US
exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

cephalexin10
24 noun, adjectiven, adj
noun

• a cephalosporin antibiotic (trade names Keflex and Keflin and Keftab) commonly prescribed for mild to moderately severe infections of the skin or ears or throat or lungs or urinary tract

channelize10
24 verbv
verb

• direct the course; determine the direction of travelling

• make a channel for; provide with a channel

• send from one person or place to another

• cause to form a channel

hawfinches10
24 nounn
noun

• a common large finch of Eurasia

hoactzines10
24 noun, adjectiven, adj
Valid word for Scrabble US
handpicked10
23 adjectiveadj
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (292)
chatteringmechanicaltechnicianchandelierenchantingexchanginganestheticchimpanzeechannelinglancashirerechargingdictaphonechiffonademechanizedchangelinganthracitecephalexinfianchettomechanisedethnicallysaccharineschliemannphoenicianfranchisedpathogenicbalanchinechanceriesdeaconshipunathleticchlorinatechannelizechasteninginchoativeantitheticdisenchantchloraminechancinesschagrinnedselachianschinwaggedhypermanicreteachingchainwheelmachinatedgynarchieschairwomenmischannelchieftainspatchinessrepatchingcharteringenchaininghandpickedenchiridiahindrancesmechanismsmechanistssandwichedmechanizessandwichesshanachiesraunchiestantichoicehesitancesbranchiestmegaphoniccachinnateanchoritesmonarchieschamferingcochairmenbackhoeinghatchelingcheloniansachinessescathepsinschinawareschampionedunachievedinterchainratchetingtheophanicfranchisernaphthenicnonethicalfranchisessennachiesescheatingchafferingechinaceashaciendadoendotheciasnatchiestheliconiasnaumachiaenaumachiescheapeningimpeachingachondritephonematicchainsawedepicanthuscharmingerendarchiesrevanchismhackneyingrevanchistmachinablecashieringmachinateschairmanedcandlefishchatelainemischanceshaloclinesinchoatelytechnicalsantiheroicdebauchingmyasthenicbechalkingenchiladashawfinchesbechancingchronaxiesaitchbonesbecharminghemocyaninmechanizerphenacetinenharmonicneophiliacpaunchiestunteachingrematchingcatarrhineshankpiecearchegoniarechangingmanchineelantechoirsrancheriaschatelainsbranchlinechapteringrainchecksrechartingchamberingschmearingchattinessunemphaticeuthanasicarchfiendsnomarchieshoactzinesphenacainephenacitescochinealsantheliceshurricaneschelationscathectingthylacinesupreachingfranchiseehematinicschinaberrydinarchieslichenaleschannelisecenotaphicacheronianacherontiapentastichchelonidaeacheronticouananichechainbrakerhyniaceaechainplategenethliacepicanthicchain-smokescherzandiappeachingmenarchialschiavoneshackneyismhibernaclecheatinglychairborneencephalichigh-octanenavarchiesencephalinphoneticalpeacherinomachinegunmachinemanmischancedpeachinessmachinemenorthocainerecatchingcasingheadechinoideamischanterparochinesascolichenbleachingsalcheringaunmechanicenchargingauthigenicencharmingmaconochieditrocheancatchinesslichanosesanarchisedanarchisesdisenchainunpatheticanarchizedunchancieranarchizesheptatonicchippewyanmechanisergleicheniamechaniseschalkinesschiromancecoachlinespreachingsphrenesiachaemoconiarhinothecacarthamineeichhorniachitarroneunthematicbranchlikephrensicalrancheriesnectar-richseannachiehexactinalhaematinicpoachinessanchoreticrecheatingtachinidaelancetfishchevisancetheodiceansynarchiesnartheciumhygienicalempeachingatchievingmonarchiseeuharmoniceuphonicalhieromancymonarchizeachaeniumscraunchierchevrotainwanchanciehemicranianephralgicunheroicalhinderancemanichaeananthericumbranchiategeocachingchaenactischauntriestheomaniacphagedenicchaenopsistheomanticlepechiniaschalsteincanachitesfianchettihabitaunceasthenopicparischaneschappeing
Phrases (27)
slim chancecane blightfair chancesedan chaircanoe birchmachine guncatherine ichain emailchain storechinese yamwar machinemexican hatzebra finchswitch canecharge unitgiant perchsquare inchpaper chainchilean nutlancet fishice machinebeacon hillbranch linekahane chaikate chopinchina asterchina stone
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen