Dictionary Only:
Profanity Off:

10-Letter Words Containing: A,H,I,N,G

 (In Any Order)
There are 416 10 letter words, 68 10 letter phrases and 0 10 letter abbr's with A,H,I,N,G in.

Best Scoring 10 Letter Words With: A,H,I,N,G

Expand?WordSave?LengthUsagePointsType
whizzbangs10
37 nounn
noun

• a small high-velocity shell; it makes a whizzing sound followed by a bang when it hits

• a firecracker that (like the whizbang shell) makes a whizzing sound followed by a loud explosion

humanizing10
25 verb, adjectivev, adj
verb

• make more humane

highwayman10
25 nounn
noun

• a holdup man who stops a vehicle and steals from it

highwaymen10
25 nounn
noun

• a holdup man who stops a vehicle and steals from it

mythmaking10
25 verb, nounv, n
Valid word for Scrabble US
hebraizing10
25 verb, nounv, n
Valid word for Scrabble US
hepatizing10
25 verb, adjectivev, adj
Valid word for Scrabble US
archaizing10
25 verb, adjectivev, adj
verb

• give an archaic appearance of character to

aphorizing10
25 verbv
verb

• speak or write in aphorisms

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (416)
washingtonchatteringstraightenrehearsingscratchingexhaustinggrandchildenglishmanshatteringenchantingexchangingbirminghamhesitatingpurchasingcunninghamharvestingsunbathingnightstandhighlanderscathinglychannelingwainwrightcharminglyheadliningunchanginghighhandedrecharginghumanizingtheologiangarishnessnightshadechangelinghandspringshampooinghearteningshenaniganbarhoppingwholegrainshanghaiedchastisinghighwaymannaughtiestweatheringsubheadingsmashinglyhypnagogichauntinglyfeatheringbellinghamlaughinglypathogenicsinghaleseprognathicharanguingcrashinglynephralgiamarshalinganglophilerockinghamfashioninghomemakingatrophyingshoemakingrephrasinghemangiomachampignonchasteningheadspringanglerfishanaglyphicvinegarishtarnishinganguishinggarnishersgarnishingearthlingsgatheringsmisshapinghighwaymenhappeningsshowcasingchagriningchagrinnedethylatinghebetatingvarnishingchinwaggedslatheringadhibitingblatheringreteachinggalumphingevanishinghacksawinginswathinggynarchiesharbingersenswathingrepatchingshearlingscharteringenchainingingatheredunswathingharbouringsheathingsunchaininguncharmingharumphingasphaltingdraughtingunlatchingshrinkagesmythmakingplanishingmegaphonicouthearinghardwiringabolishinghankeringslanguisheschamferingbackhoeingnighthawkshatchelinginhabitingstomachingchamoisinghatchlingssharpeninghusbandingratchetingshinguardsgarnisheedholidayinggarnisheeslonghairedescheatingplaythingschariotingchafferingoverhatingringhalsesmahoganiestallyhoingthatchingssiphonagesslashinglyhormogoniarehandlingcheapeninghobnailingimpeachingmishearingstringhaltshavelingslightplanerehearingscohabitinghebraizinghepatizingcharmingerhackneyingbethankingharnessingcashieringlanguisherprewashingshallowingherniatingharpooningclaughtinginearthingantigrowthscraichingspringheadscraighingshanghaiercarhoppingcohobatingalightmentharsheningleatheringdebauchingunchairingwharfingerhairspringsulphatinguphoardingbechalkinghandselingbechancingunchargingbecharminghardeningsfraughtingboxhaulingkeelhalingphreakingshearkeningunearthingthrashingsarchaisingunteachingarchaizingrematchingarchegoniarechangingwhizzbangspreshapingchapteringrechartingchamberingunleashingschmearingshikarringhumanisingtrauchlingchivariinglanguishednightfallscochairinghosannaingnightmareslaughlineshansellingwampishingcraunchingkurbashinghopsackingpreheatingoutshaminghoarseningcathectingchampaignswhipsawingwingchairsaphorisinggranolithsshagginessaphorizinghamstringsupreachingbreathingsstaunchingindraughtsunhoardingathetizinggunmanshipphagomaniahushabyinggynophobiahallallingexhumatingchicaningsspreathingphalangidschaffinglygrassfinchupflashingsplashingsforhailingsnatchingsshauchlingsplatchingrhubarbingepitaphingashlaringsanhingidaesiphonogammishappingdisgarnishthingmabobthingmajigashleringshepatisinginhumatinggosainthangosan-chikugenethliachebraisinghigh-handedappeachingbraunchingcheatinglyrh-negativephansigarsreheatingsloathinglystealthinghigh-octanemachinegunclauchtingdining-hallrecatchingcasingheadthunbergiasphingidaeallnightermachiningsharassingsvanishingsspringhaasabhorringsspringhaltspringhaseinchoatingqinghaosushalogenoidchantinglyhypsiglenashamblingsharrowingsbleachingsalcheringanarghiliesingathererupheapingshugueniniaenchargingninkharsagauthigenicninkhursagencharmingscranchinggashlinessflaughtingauthoringsflaunchingdishablingcliffhangsgleicheniathraipingsmoehringiaaffrightenshoegazinggenophobiathingamieslong-hairedthrapplingpreachingsbinghamtonchallaningenhearsingfatheringschiliagonsangiopathyorchardingplanigraphunhappyinghijackingsbranchingsgnaphaliumchittagongstanchingsscrauchinghaymakingsscraughinghegemonialheartlingsgraunchinghomorganictithingmantanghininsunhattingsearbashingflanchingsguarishingnightclassrecheatingknightagesgianthoodsknightheadbarasinghahygienicalempeachingatchievinggiantshipsnightgearsunhearsinghexagynianunheartingupcatchinghammeringsring-shapedshotmakingaphetisingaphetizingbeheadingsgnashinglychiackingsnephralgicgymnorhinathwackingslightermananglophilsgeocachingshadowingsthwartingswing-shapedrangershipnightwearsphagedenicinhaustingzincographerignathusoverhalingphalangidaphalangistinhearsingclashinglychangjiangharmdoingsphalangiumathetisingschappeing
Phrases (68)
whizz alongsun bathinggenus aphisright brainpigeon hawkhanging flyhorse grainhuman beinganchor ringbirth pangsbridge handcane blighthearing aidgenus avahinight watchnautch girlhigh germantangle withtaking holdgrass finchpanel lighthigh seasonbean blightmachine gunngaio marshwhaling gunheating oilheating padstrap hingechain tongsright alongright anglehelix anglewatch nighttowing pathhang gliderhiring hallking arthurenglish oakbathing capbathing tubhigher rankcharge unitbathtub gingiant conchhans geigergiant hiveshuman rightgiant perchhearing dognag hammadiwishing capholland ginangler fishhalf gainernight latchshingle oaknight ravenchang jianggive thanksnight snakehaying timehigh and lowsea bathingganoid fishheat enginechina grasswashing day
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen