10-Letter Words Containing: A,G,I,K,L,S
(In Any Order)
There are 23 10 letter words,
6 10 letter phrases and
0 10 letter abbr's with
A,G,I,K,L,S in.
Best Scoring 10 Letter Words With: A,G,I,K,L,S
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| jacklights | 10 | 27 | verb, nounv, n | |||||
noun • a light used as a lure in hunting or fishing at night verb • hunt with a jacklight | ||||||||
| backlights | 10 | 22 | nounn | |||||
noun • A spotlight that illuminates a photographic subject from behind. • Light that is behind a photographic subject. • A light attached to an LCD display. • The rear window of a motor car. | ||||||||
| skylarking | 10 | 22 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
| lawmakings | 10 | 20 | ||||||
noun • the act of making or enacting laws | ||||||||
| flagsticks | 10 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cracklings | 10 | 19 | nounn | |||||
noun • the crisp residue left after lard has been rendered | ||||||||
| slingbacks | 10 | 19 | ||||||
noun • a shoe that has a strap that wraps around the heel | ||||||||
| gavelkinds | 10 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sneakingly | 10 | 18 | adverbadv | |||||
adverb • in a sneaky manner | ||||||||
| ankylosing | 10 | 18 | adjectiveadj | |||||
verb • produce ankylosis by surgery • undergo ankylosis | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (23)
slackeningspankinglysneakinglycracklingsbacklightsslingbackslawmakingsflagsticksskylarkinggavelkindsgrimalkinsankylosingjacklightsalkalisinglossmakingginkgoalesspeakinglygrillsteakdekalogieseresh-kigalereshkigalspracklingsparklingsPhrases (6)
king salmongasket coilsailor kingenglish oaksex linkageshingle oak
