Dictionary Only:
Profanity Off:

10-Letter Words Containing: A,G,G,I,N,N

 (In Any Order)
There are 125 10 letter words, 12 10 letter phrases and 0 10 letter abbr's with A,G,G,I,N,N in.

Best Scoring 10 Letter Words With: A,G,G,I,N,N

Expand?WordSave?LengthUsagePointsType
exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

paganizing10
23 verbv
verb

• make pagan in character

organizing10
21 verb, noun, adjectivev, n, adj
verb

• create (as an entity)

• cause to be structured or ordered or operating according to some principle or idea

• plan and direct (a complex undertaking)

• bring order and organization to

• arrange by systematic planning and united effort

• form or join a union

magnifying10
20 verb, adverb, adjectivev, adv, adj
verb

• increase in size, volume or significance

• to enlarge beyond bounds or the truth

• make large

unchanging10
17 adjectiveadj
adjective satellite

• conforming to the same principles or course of action over time

• showing little if any change

changeling10
17 nounn
noun

• a person of subnormal intelligence

• a child secretly exchanged for another in infancy

chagrining10
17 verb, adjectivev, adj
noun

• strong feelings of embarrassment

verb

• cause to feel shame; hurt the pride of

glancingly10
17 adverbadv
Valid word for Scrabble US
scavenging10
17 verb, nounv, n
verb

• To collect and remove refuse, or to search through refuse, carrion, or abandoned items for useful material

• To remove unwanted material from something, especially to purify molten metal by removing impurities

• To expel the exhaust gases from the cylinder of an internal combustion engine, and draw in air for the next cycle

• To feed on carrion or refuse

noun

• The act of searching through refuse for useful material.

adjective

• That eats carrion

uncharging10
17 adverbadv
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (125)
organizingbargainingexchanginggeneratingstranglingmagnifyingorganisingnavigatingunchangingsignallingimaginingschangelingdiagnosingreengaginguntanglingstagnatinggingersnapagglutininingrainingharanguingelongatingoceangoingunflaggingenvisagingengaginglyclangoringanguishinggarnishingensilagingcomanagingchagriningglancinglycongealingdragooningendamagingastringingengraftingengrailingunsnaggingengrainingoutgainingengravingsgallantingingraftingarraigningscavengingnegativingregrantinggadrooninggladdeningindagatinggarlandingrealigninggarmentingrenegadingangulatingganglionicgreateninggangreningoutrangingunguardinggantletingentanglingunchargingestrangingoutgnawinggorgonianssingalongsniggardingpaganisingrechangingpaganizinggeminatingbegroaningabnegatingangiogenicderaigningpaginatingdognappingaugmentingmargentingbadinagingparagoninggaingivinggainsayingtwanginglywranglingstwanglingsbangsringsengraffingilang-ilangvinegaringguomindangengraspingknagginessenchargingnintinuggaenguardingnyiragongolong-actingkarangaingenraungingvintagingsspanglingssanguininggraunchinglanguaginggardeningssaginatingdognapingsbranglingssignalingsgraddaningtanglinglydanglinglyanglifyinginveaglinggnashinglygrannieingspranglinggammoningsologoaninggroaninglyslanginglychangjiang
Phrases (12)
genus vignahanging flywhaling gunginger snappiping guangatling gunking orangegrind organgain groundnageia nagichang jiangevening bag
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen