Dictionary Only:
Profanity Off:

10-Letter Words Containing: A,G,G

 (In Any Order)
There are 517 10 letter words, 114 10 letter phrases and 0 10 letter abbr's with A,G,G in.

Best Scoring 10 Letter Words With: A,G,G

Expand?WordSave?LengthUsagePointsType
zigzagging10
32 verb, adjectivev, adj
noun

• an angular shape characterized by sharp turns in alternating directions

adverb

• in a zigzag course or on a zigzag path

adjective satellite

• having short sharp turns or angles

verb

• travel along a zigzag path

zigzaggers10
31 noun, adjectiven, adj
Valid word for Scrabble US
piggybacks10
25 verbv
noun

• the act of carrying something piggyback

adverb

• on a railroad flatcar

• on the back or shoulder or astraddle on the hip

verb

• ride on someone's shoulders or back

• haul truck trailers loaded with commodities on railroad cars

• haul by railroad car

• support on the back and shoulders

• bring into alignment with

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

logjamming10
23 verb, nounv, n
Valid word for Scrabble US
paganizing10
23 verbv
verb

• make pagan in character

hygrograph10
23 nounn
Valid word for Scrabble US
graecizing10
23 verb, nounv, n
verb

• To render Grecian, or cause (a word or phrase in another language) to take a Greek form.

• To translate into Greek.

• To conform to the Greek custom, especially in speech.

hypnagogic10
22 adjectiveadj
adjective satellite

• sleep inducing

aggrandize10
22 verbv
verb

• add details to

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (517)
engagementaggressiveexaggerateaggressionorganizinggraduatingpilgrimagestaggeringgeologicalbargainingexchanginggeneratingaggravatedstranglinggeographicmagnifyinggratifyingorganisingsabotagingcaravaggiogorgonzolanavigatingcongregatejuggernautgargantuanregulatingsegregatedgarbagemanunchangingrechargingswaggeringdisengagedlegalizingsignallingimaginingsemigratingchangelinggregarioustailgatingdisgracingfumigatingzigzaggingremortgagediagnosingstargazingaggregatedtriggermanhypnagogicreengaginggraphologylaughinglyleveragingsandbaggedirrigatinguntanglingstragglingloggerheadstagnatinggingersnapprograminggeographerdelegatingagglutininingrainingabrogatingdegaussingharanguingembargoingelongatingoceangoingaggrandizerelegatingunflaggingpedagogicslitigatingbudgerigarenvisagingbedraggledglaswegiancongregantgangrenousbackloggeddegreasinglegalisingbrigandageaggrandiseengaginglyclangoringalmsgivingfreightagealgolagniaanagogicalanguishingligaturinggarnishingglamouringcragginessensilaginggatheringscomanagingdragginglychagriningglancinglychinwaggedcongealingdragooningendamagingcaregivingpedagoguesvegetatinggangplankseggbeatersastringingmortgagorsgalumphinggarrottingdamaginglyjaggednessdialoguingengraftingengrailingraggedieststragglersunsnaggingpiggybacksengrainingoutgainingflagginglytobogganedtobogganerdefraggingoutgassingsluggardlyengravingsderogatingmitigatinglogjamminglevigatingarpeggiateaggravatesoutarguinglogographsgallantingdisengagesaggressinggambollingaggressorsingraftingaggrievingdraughtingarraigningscavengingobligatinggalleryingnegativingdaggerlikeregrantingsegregatesgadrooningoutdraggedgladdeninggametangiagloatinglygregarinesgargantuasindagatingoutbraggedmisgauginggarlandingpackagingscogitatingarrogatingrealigninggarlickingswaggerersgarmentinggearchangehaggadistscatalogingassegaiingpressgangsgraffitingrenegadingangulatingleagueringbeflaggingstravaginggangbangerglissadingpargettinghagiologicgangbustergigacyclesregelatingdesugaringgigantismspedagogiesjugulatingganglionicalgologiesalgologistearwigginggreateningmortgageesbalbrigganmortgagersgaufferingmortgaginggangreningoutranginggrosgrainsbedragglesscraggieststraggliergoosegrassclaughtingscragglierlawgivingsscraighingagrologiesbeggardomsdefraggersorganologyunguardingsialagoguegantletinggrapplingsgeophagiasgeophagiesgraspinglymystagoguegalingalesmagaloguesentanglingoutglaringgreengagesangelologyunchargingfraughtingredamagingestranginggoddammingoutgnawingbegladdingredarguingaggregatesgorgoniansmegagametegadgeteersgadgetriessingalongsbeggarweedniggardinggarbagemengimballingpaganisingsynagoguesdivagatingregraftingglaciatingsegregantsrechangingpaganizinggeminatingbegroaningabnegatingangiogenicangiogramsglaciologylangridgesdemagogiesdemagogingderaigningdemagoguedpaginatingzigzaggersdemagoguesabsterginggrangerismoligophagyergographsdognappingseignorageaugmentingmargentinggravellingbadinagingwigwaggersfaggotingswigwaggingparagoningfaggotriesreflaggingassagaiingpargetingslighteragesandbaggergaingivingoperagoingplaygoingsgallonageshygrographshagginessstaggerersdiagramingjaggheriesmisgradingraggednessslanguagesshaggymanegainsayinggraecizingcagmaggingevulgatingorangutangupdraggingglossalgiahandbaggedquagginessbagpipingssogdolageraccoragingaggravatorbagswingergastralgiaquagmiringaveragingsmamaguyinggangboardsgorgonaceagarottingsmangemangeaggregatorequipagingvoetgangerdragoonagethingmajigagregationgangliatedtwanginglypedagogismgangliformgalravagedpedagoguedgalravageswranglingstwanglingsgeologiansbraggartlybangsringsengraffingbragginglyalligatingilang-ilangglucophagedebaggingsgenealogicgod-fearingtragopogonorganogenyorganogramscragglingdisgradingflagginessprogradinggasbaggingvinegaringsluggabedsgaldragonsguomindangengraspingpaedagogicpaedagogueagrologistginkgoalesbeggarhoodknagginessgalengalessialagogicengrenagessegregatorcottagingsencharginggargoylismsialogogicmystagogicgroundagesburglaringsialogoguehaemagoguegeophagismbareleggedgeophagistmessagingsflaughtingrampagingsgeophagousmystagogusylang-ylangnintinuggagaliongeesgambadoingenguardinggillravagewhiggamorenyiragongogabionagesrampaugingegurgitatelong-actingfraughtagekarangaingdagger-likealms-givingenraungingmaggotiestapagogicalmaggotoriaploughgateshoegazingvintagingsarpeggionegilravagedgilravagerlogographygilravagesbordragingspanglingshydragoguedziggetaisgaragistesbaggagemanniggardisebudgerygahniggardizetoeraggersassuagingssegregablefatigatingwagglinglycholagogiccholagoguedegearingsregratingschittagongwaggonettewaggonlesssanguiningwaggonloadscraughingdemagogismgrangerisegeratologygraunchingergatogynelanguaginggardeningszigzaggerybeguinagesracegoingsgastralgicguarishingsaginatingknightagesgrangerizejigajiggedalgolagnicdognapingsgametogenytarbogginssharawaggijigajoggedhypnagoguegyrovaguesgargarisedbranglingsgargarisesgingeradesnightgearssignalingsgargarismsgargarizedgargarizesgastrologygraddaningparagoguesterengganutanglinglyzugzwangedbedagglingflag-wavingdanglinglyanglifyingspongebagsinveaglingjiggermastgnashinglygrannieinggammockingspranglinggarlandageagnoiologygammoningsgalloglassgeocachingologoaningremigatingdugongidaekiggelariatabogganedgroaninglyhemagogueshaggadicalslanginglyratbaggerychangjianggraecising
Phrases (114)
edgar degasedgar guestgenus vignagenu valgumget-up-and-gosignal flaghanging flybroad gaugegenus fagusgenus agavebeggar licestrong galelegal rightgas fittinggrape sugargenus tsugaflag signalhigh germanvacuum gagegenus glauxgeisha girlgarage salesausage doggarbage cansage grousegilgai soilpango pangogarbage manget the hanggeorge sandget weavinggrama grasslygaeid buggenus griasswamp buggygreta garbowhaling gunicing sugarright alongright anglegenus kogiadepth gaugewagga waggaegg candleregg crackerwilde daggaginger snappiping guanegg-and-dartright stagehang glidergondang waxyi languageham and eggsgatling gungreen algaeblowing gasmarsh buggygarment baggauge bosondagger ferngenus agamabig leaguerpetrol gagegreen glandking orangedigger wasphans geigerwater gaugebaggage cargenus ajugaguinea goldfungus gnatliving wagesenegal gumgrind organhearing doggolden agergaming cardgain groundnageia nagiluggage vangeneva gowngrace of godwiggle nailgenus trigagenus gadusgas guzzlerzig-zag foldgenus galaxgolden gategolden gramgrugru palmmick jaggergas mileagebeach buggygo a long waychang jiangpoached egggang ploughgulf of rigagrocery baggenus gaviagenus tungagoose grassgenus saigaevening baggebang palmgreat grossangora goatgenus gereastrain gagestage rightgreg norman
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen