10-Letter Words Containing: A,D,Y,I,S,H
(In Any Order)
There are 56 10 letter words,
5 10 letter phrases and
0 10 letter abbr's with
A,D,Y,I,S,H in.
Best Scoring 10 Letter Words With: A,D,Y,I,S,H
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
hydrazides | 10 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
hydrazines | 10 | 26 | nounn | |||||
noun • a colorless fuming corrosive liquid; a powerful reducing agent; used chiefly in rocket fuels | ||||||||
dwarfishly | 10 | 23 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
dysthymias | 10 | 22 | nounn | |||||
noun • mild chronic depression | ||||||||
switchyard | 10 | 22 | nounn | |||||
noun • Part of a railway with an arrangement of switches (or points) allowing trains to be diverted and reassembled. | ||||||||
dysphasics | 10 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
dithyrambs | 10 | 21 | nounn | |||||
noun • a wildly enthusiastic speech or piece of writing • (ancient Greece) a passionate hymn (usually in honor of Dionysus) | ||||||||
hybridomas | 10 | 21 | nounn | |||||
noun • a hybrid cell resulting from the fusion of a lymphocyte and a tumor cell; used to culture a specific monoclonal antibody | ||||||||
nymphalids | 10 | 21 | nounn | |||||
noun • medium to large butterflies found worldwide typically having brightly colored wings and much-reduced nonfunctional forelegs carried folded on the breast | ||||||||
dandyishly | 10 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 10 Letter Words
Words (56)
hydraulicsdisharmonydysarthriaholidayersdysphoriasanhydridesadhesivelyanhydritesfairyhoodsdiaphysealdiaphysialdysphagiasdysphasiasdysphasicsdysphoniasdithyrambsdysthymiashybridomasdwarfishlyladyfisheshydrationschrysalidshydrazideshydrazinesnymphalidsdandyishlyswitchyardthylakoidsdaisywheelwhitsundaydyschroiasanhydrosisdysgraphicthyrsoidaldyspathieshyaliniseddysphagieskyphosidaesphyrnidaehairdryersdysthesiasdysthymiacdysgraphiadystrophiahydantoinshydraemiasdichromasyhydrotaxishydrastinedaisy-chaindiachylonsdiachylumsdahabiyahsdahabiyehschlamydiashydramniosPhrases (5)
white daisychild's playdaisy wheelshowy daisywashing day