10-Letter Words Containing: A,D,I,R,S,Y
(In Any Order)
There are 84 10 letter words,
5 10 letter phrases and
0 10 letter abbr's with
A,D,I,R,S,Y in.
Best Scoring 10 Letter Words With: A,D,I,R,S,Y
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| hydrazides | 10 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hydrazines | 10 | 26 | nounn | |||||
noun • a colorless fuming corrosive liquid; a powerful reducing agent; used chiefly in rocket fuels | ||||||||
| pyridoxals | 10 | 23 | noun, adjectiven, adj | |||||
noun • a B vitamin that is essential for metabolism of amino acids and starch | ||||||||
| dwarfishly | 10 | 23 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| brickyards | 10 | 22 | nounn | |||||
noun • a place where bricks are made and sold | ||||||||
| switchyard | 10 | 22 | nounn | |||||
noun • Part of a railway with an arrangement of switches (or points) allowing trains to be diverted and reassembled. | ||||||||
| dithyrambs | 10 | 21 | nounn | |||||
noun • a wildly enthusiastic speech or piece of writing • (ancient Greece) a passionate hymn (usually in honor of Dionysus) | ||||||||
| hybridomas | 10 | 21 | nounn | |||||
noun • a hybrid cell resulting from the fusion of a lymphocyte and a tumor cell; used to culture a specific monoclonal antibody | ||||||||
| yardsticks | 10 | 20 | nounn | |||||
noun • a measure or standard used for comparison • a ruler or tape that is three feet long | ||||||||
| fairyhoods | 10 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 10 Letter Words
Words (84)
solidarityhydraulicssubsidiarydispensarydisharmonydepositarydysarthriaholidayersresiduallydysphoriasredisplaysayurvedicsdisplayersdisarrayedbrickyardsyardstickstyranniseddairymaidsdyscrasiasanhydridesanhydritespyralididsfairyhoodsgynandriesfairylandspyranosidedithyrambsdayspringspyridoxalshybridomasdwarfishlysyndicatorarytenoidshydrationsradiolysischrysalidsmydriaticshydrazideshydrazinesbipyramidsradiolysespresidiarydynamiterscaryatidesswitchyardamaryllidsmartyrisedsidereallydyschroiasdyscrasiteanhydrosisbradyseismdysgraphicthyrsoidaldecrassifydasyuridaegynandrismdyaus-pitarpyramidistdissuasorypyramidonssphyrnidaedyspraxiashairdryerskirkyairdsstrainedlydysgraphiadystrophiafaldistorykailyairdshydraemiasdichromasysynandriumhydrotaxisadvisatoryhydrastineradioscopyreaedifyesspray-driedbridlewaysmistraynedscabriditystridewayshydramniosPhrases (5)
paris daisycrown daisydwarf daisyalkyd resinquai d'orsay
