Words Containing: A,N,C,H,I,E,S,T
(In Any Order)
There are 820 words,
1,545 phrases and
0 abbr's with
A,N,C,H,I,E,S,T in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
hoactzines | 10 | 24 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
myasthenics | 11 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
stickhandle | 11 | 21 | verbv | |||||
verb • To maintain individual possession of the puck or ball by controlling it with movements of one's stick, especially to do so in a skillful manner. • (by extension) To deal capably and swiftly with a situation, especially in a manner which deflects potential problems. | ||||||||
jacinthes | 9 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
mechanistic | 11 | 20 | adjectiveadj | |||||
adjective • of or relating to the philosophical theory of mechanism adjective satellite • explained in terms of physical forces | ||||||||
despatching | 11 | 20 | verbv | |||||
noun • an official report (usually sent in haste) • the property of being prompt and efficient • killing a person or animal • the act of sending off something verb • send away towards a designated goal | ||||||||
myasthenic | 10 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
charmingest | 11 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
catechising | 11 | 19 | verb, nounv, n | |||||
verb • give religious instructions to • examine through questioning and answering | ||||||||
revanchists | 11 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (39)
anestheticchasteningdisenchantchieftainspatchinessmechanistsraunchiesthesitancesbranchiestanchoritescathepsinsescheatingsnatchiestepicanthusrevanchistmachinatestechnicalsmyasthenicaitchbonespaunchiestantechoirschatelainschattinesseuthanasichoactzinesphenacitesantheliceschelationsthylacineshematinicspentastichmischantercatchinesslancetfishchaenactis
...View all with 10 letters...
Phrases (5)
chain storeswitch canelancet fishchina asterchina stoneWords (77)
anaestheticpantheisticunaestheticmechanisticestheticiananthracitescachinnatescharmingeststarchinesstechniciansmyasthenicsanestheticsdisenchantscatechisingdespatchinghesitanciesstanchionedethicalnessstickhandlepentarchieschlorinatescantharidesrevanchistscatarrhinescanthitisesantihelicesinchoativescalisthenicmacintoshesstenobathiclecithinasemisteachingchatelainesinterarchesphenacetins
...View all with 11 letters...
Phrases (10)
tennis coachsection handseat cushionethics panelscratch linechinese datetennis matchslot machinespinach beetchina closetWords (109)
enthusiasticencephalitiscalisthenicsanaestheticsdisenchantedstenographicgemeinschaftneurasthenicchastisementaestheticianstickhandledstickhandlesschematizingimpeachmentsunhystericalhallucinatesinchoatenesschanticleerschiropteransunchastitieskitchenwaresachievementsstickhandlerinterchangesinheritancesnonaestheticphoneticiansrhetoricianscandlelightsplainclothesenchainmentsmackintoshesantihystericdisenchanterpatchinesses
...View all with 12 letters...
Phrases (21)
genus tarichaauction housecanister shotwhite arsenicchristian eraasthenic typefranchise taxgenus certhiachaim soutineearth science
...View all with 12 letters...
Words (126)
orchestratingunsympatheticthoracentesisorchestrationsyntheticallyterpsichoreandisenchantingchristianizedchieftainshipcontainershiptheoreticiansanalphabeticspantechniconsnonarchitectsauthenticatestechnophobiasnonhystericalchastisementsarchegoniatesaestheticiansdechlorinatespreanesthetictrichopteransstickhandlersinterchangerslycanthropiescharlatanriesdodecaphonistpsychastheniapsychasthenicecholocationsparasyntheticstarchinesseshandicrafterspantheistical
...View all with 13 letters...
Phrases (39)
frances wrightsandwich platemachine stitchcontainer shipgenus hepaticapiston chambershaving cuttercanada thistlesheepskin coatchristian name
...View all with 13 letters...
Words (147)
accomplishmentapprenticeshipthermodynamicscholinesteraseschoolteachingnarcosynthesisunenthusiasticdisenchantmentcharacterisingdisinheritancearchitectonicsmethodicalnesshandicraftsmenbronchiectasestechnicalitiesinchoatenessescinematographsmetaphysiciansauthenticatorsauthenticitiesmathematicianshedonisticallymechanizationsantirheumaticscharitablenessacetaminophenscountershadingcopartnershipscontainershipsarithmeticiansdecamethoniumshypothecationsactinomorphiestrisoctahedrondodecaphonists
...View all with 14 letters...
Phrases (60)
breathing spacecastle in the airgaston lachaisebristol channelchinese lanternbritish cabinetmale chauvinistchicken scratchachromatic lenschief assistant
...View all with 14 letters...
Words (129)
pithecanthropusunsophisticatedinterscholasticenfranchisementplainclothesmanneuropsychiatrykinestheticallyphosphocreatineaccomplishmentsechinodermatousnonachievementsschematizationstrisoctahedronsauthenticationsdisenchantinglypsychometriciancyproheptadinesanticholesterolorchestrationalcholinesterasesapprenticeshipsreorchestratingreorchestrationdisinheritancesphenomenalisticchangeabilitieschemotaxonomieschemotaxonomistchannelizationsmachinabilitiesmechanisticallyencephalitogenspantheisticallyplainclothesmendichloroethanes
...View all with 15 letters...
Phrases (96)
athletic contestacross the nationernst boris chainmythical monsteranesthetic agentsalix sitchensisalbert michelsonancestor worshipgenus tichodromaaction mechanism
...View all with 15 letters...
Words (59)
enthusiasticallyuncharacteristiccharacterisationoverenthusiasticacquaintanceshipneuropsychiatricantitechnologiespostencephaliticarchconservativemonotheisticallyfeatherstitchinganthropocentrismstenographicallyuntouchabilitiesstereophonicallycyanoethylationshippocastanaceaemachineabilitiespharmacogeneticskinaestheticallypharmacokineticslymphangiectasialymphangiectasisfrenchificationsanti-aestheticismnanotechnologiesconservatorshipsinterchromosomalacetophenetidinsneurasthenicallymechanochemistrybiosyntheticallyphosphocreatinesreorchestrationsturbomachineries
...View all with 16 letters...
Phrases (109)
manihot esculentachristian huygensochotona princepstendon of achillesphotostat machinechristmas presentgenus cheilanthesgenus cheiranthusmechanical stressmechanical system
...View all with 16 letters...
Words (36)
nonmathematiciansantischizophreniaantischizophrenicleukoencephalitisdisfranchisementsthrombocytopeniascrashworthinessesarchconservativesencephalomyelitisstraightjacketingbacteriorhodopsindehumidificationsacquaintanceshipsbiomathematiciansmechanoreceptionsneuropsychiatriesneuropsychiatristmerchantabilitiesunsympatheticallydesynchronisationdesynchronizationanthropocentrismscharacterizationsaustralopithecinetracheobronchitisunchangeabilitiesnonaccomplishmentchorioallantoidesoverorchestratingunderachievementsdihydroxyacetonestechnicalizationspithecanthropinesexchangeabilitiesmischaracterizing
...View all with 17 letters...
Phrases (132)
horizontal sectionacherontia atroposorder ornithischiatrichechus manatuspython reticulatuschristopher carsonfashion collectiongenus acridotheresarthur schlesingeralthea officinalis
...View all with 17 letters...
Words (20)
disenfranchisementmonochromaticitiesarchaeoastronomiesaustralopithecinesbacteriorhodopsinscharacteristicnessdehydrochlorinatesmechanochemistriesaerothermodynamicsneuropsychiatristsanticholinesterasephotoreactivationschlortetracyclinesuncharitablenessesphotosyntheticallycytoarchitectonicsethnomusicologicalunenthusiasticallyhypernationalistictheatricalizationsPhrases (137)
lachrymal secretionantipsychotic agentnational censorshipgenus chamaecytisuschemical operationsascension of the lordkamchatka peninsulaoscar hammerstein iiarthur m. schlesingeraccordance of rights
...View all with 18 letters...
Words (26)
disenfranchisementsencephalomeningitisresorcinolphthaleinanarcho-collectivismcytopathogenicitiesimmunohistochemicalphenomenalisticallypseudohallucinationphosphatidylcholinephosphofructokinaseneuropharmacologistcontradistinguishedcontradistinguishesmeningoencephalitiselectroretinographsencephalomyelitidesunapproachabilitiesanticholinesterasesphotoreconnaissancediethylcarbamazinesinterchangeablenesshyperconcentrationshypoadrenocorticismphacoemulsificationexhibitionisticallymischaracterizationPhrases (121)
hydrastis canadensisgiles lytton stracheycaesalpinia echinatastephen michael reichchinese monetary unituniversity of chicagobattle of the granicussymphytum officinaletransmission channelarchosaurian reptile
...View all with 19 letters...
Words (19)
uncharacteristicallyoverenthusiasticallyhyperadrenocorticismphenylthiocarbamidesinterchangeabilitiesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneuropsychiatricallymagnetohydrodynamicsanthropocentricitiesencephalomyocarditispseudocholinesterasephotoreconnaissancespseudosophisticationmischaracterizationsPhrases (118)
photographic emulsiondivision tracheophytabalance sheet analysisislamic calendar monthrepublic of kazakhstanernst heinrich haeckelcantharellus cibariussouth american countryatmospheric conditioncapital of rhode island
...View all with 20 letters...
Words (8)
interchangeablenessesacetylcholinesterasesadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasespseudosophisticationstetrahydrocannabinolsPhrases (114)
acrocentric chromosomehelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumphilosophical doctrinetelephone conversationtransmission mechanismcapital of new hampshirephascolarctos cinereusmathematical statement
...View all with 21 letters...
Words (1)
encephalomyocarditisesPhrases (116)
viola tricolor hortensisteacher-student relationcapital of liechtensteinrhythm and blues musicianpartnership certificateivan sergeevich turgenevcharacter assassinationarthur meier schlesingerfamily branchiostomidaehenri de toulouse-lautrec
...View all with 22 letters...
Words (3)
laryngotracheobronchitiselectroencephalographiesdichlorodifluoromethanesPhrases (60)
trip the light fantastic toearthur meier schlesinger jr.richard buckminster fullertechnology administrationcomprehensive examinationhypersensitivity reactioncharles augustus lindberghcharles camille saint-saensbattle of chancellorsvillehospitalization insurance
...View all with 24 letters...
Phrases (67)
battle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionherpes simplex encephalitisandrei arsenevich tarkovskygreat plains of north america
...View all with 25 letters...
Phrases (46)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidbacon-lettuce-tomato sandwichhunting and gathering societywar of the austrian successionanton grigorevich rubinsteinjames abbott mcneill whistler
...View all with 26 letters...
Phrases (30)
nikita sergeyevich khrushchevelectromechanical transducerdirector-stockholder relationjerusalem artichoke sunflowercryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic processhyacinthus orientalis albulusthrough empirical observation
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (38)
marcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdepartment of homeland securitygrace ethel cecile rosalie allensergei mikhailovich eisensteincongregation of the inquisitiondissident irish republican army
...View all with 28 letters...
Phrases (24)
chemical decomposition reactiondisorganized type schizophreniasouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitcongregational christian churchhydrangea macrophylla hortensisconstitution of the united statessecond epistle to the corinthiansgeorges joseph christian simenon
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedenttechnical analysis of stock trendssisters of st. michael the archangel
...View all with 30 letters...
Phrases (19)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologyfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wildefrancoise-athenais de rochechouart
...View all with 31 letters...
Phrases (9)
hierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationtheory of electrolytic dissociationedmond louis antoine huot de goncourtyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosischrysanthemum coronarium spatiosumamaranthus hybridus erythrostachysPhrases (15)
breach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nationsbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadetransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing