Words Containing: E,N,C,A,S,H
(In Any Order)
There are 2,152 words,
2,924 phrases and
0 abbr's with
E,N,C,A,S,H in.
Best Scoring Words With: E,N,C,A,S,H
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | schanze | 7 | 21 | nounn | |||
2 | hanches | 7 | 15 | nounn | |||
3 | chances | 7 | 14 | adverb, nounadv, n | |||
4 | manches | 7 | 14 | ||||
5 | pechans | 7 | 14 | ||||
6 | changes | 7 | 13 | nounn | |||
7 | ganches | 7 | 13 | ||||
8 | chasten | 7 | 12 | verbv | |||
9 | enchase | 7 | 12 | verbv | |||
10 | ranches | 7 | 12 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (81)
channels13snatcher13szechwanuncashed14schnabelszechuanunchaste13chessman15asthenic13chancers15echidnas14chancres15snatched14snatches13cheapens15haunches16encashed14machines15enchains13enchants13planches15enhances13chastens13branches15stanched14stanches13tranches13achiness13panaches15ganaches14chancels15brechans15chicanes15chazzens31changers14
...View all with 8 letters...
Words (138)
searching15mechanics18mechanism18franchise17unscathed15cavendish18schnauzer23hesitancy17seneschal14cheapness16unshackle18cheongsam17chanteuse14hesitance14mischance18hanseatic14chariness14selachian14cenotaphs16merchants16pentarchs16snatchers14menarches16deckhands20mechanist16yachtsmen19chantages15canephors16bechances18planchets16chaperons16enhancers14chastened15chastener14shanachie17
...View all with 9 letters...
Phrases (11)
cone shapesea changechina roseskeen archskene archernst machsea urchinsex changecashew nutchest pain
...View all with 9 letters...
Words (244)
manchester17anesthetic15charleston15secondhand17lancashiremunchausenchangeless16mechanised18saccharine17schliemannfranchised19chanceries17deaconship18unshackled20chasteness15chastening16gaucheness16disenchant16chanciness17selachians15scherzando25encashment17gynarchies19mischannel17chieftains18patchiness17chanteuses15benchmarks23catchments19hindrances16relaunches15mechanisms19mechanists17sandwiched20mechanizes26
...View all with 10 letters...
Phrases (24)
slim chancesecond handsedan chairranch housechain storesecond halfgenus charabone-ash cupchinese yamgenus phoca
...View all with 10 letters...
Words (303)
merchandise19anaesthetic16charlestownenchantress16deutschlandpantheistic18schenectadychairperson18marchioness18uncrushable18unpurchased19unaesthetic16mechanistic20esthetician16scenography22graphicness19shellacking21paunchiness18chicaneries18spinachlike22chaffinches27anthracites16changelings18changeovers20cachinnates18charmingest19chainwheels22starchiness16carragheens17chansonnier16abhorrences18prelaunches18technicians18cacophonies20technocrats18
...View all with 11 letters...
Phrases (60)
sheet anchorchinese walldance schoolgenus achetatennis coachphase changestate changeharness racesection handseat cushion
...View all with 11 letters...
Words (317)
enthusiastic17anchorperson19schopenhauerspeechmaking26encephalitis19calisthenics19happenstance21merchandiser20anaesthetics17disenchanted19saskatchewanundischarged20stenographic20packinghouse24braunschweiggemeinschaft23shortchanged22neurasthenic17necrophagous20watchfulness23unsearchable19chastisement19enfranchised21scenographer20merchandised21elasmobranch21clannishness17disfranchise21aesthetician17physicalness22stickhandled23stickhandles22photoscanned20gauchenesses18schematizing29
...View all with 12 letters...
Phrases (95)
charnel housechinese aniseconcave shapestephen cranegenus chamaeaernst haeckelgenus tarichagenus halcyongenus arachishunter's sauce
...View all with 12 letters...
Words (311)
schizophrenia32schadenfreude23merchandising22chrysanthemum28orchestrating19unsympathetic25psychoanalyze35housecleaning19thoracentesis18orchestration18synthetically24sharecropping23terpsichorean20disenchanting20affenpinscher26changefulness22psychoanalyse26christianized28chieftainship26aeromechanics22containership20disfranchised23mesencephalon22commandership25prosencephala22disfranchises22elasmobranchs22theoreticians18iconographers21analphabetics22accouchements24iconographies21handcraftsmen24pantechnicons22hallucinogens19
...View all with 13 letters...
Phrases (140)
dwarf chestnutharvey cushingchannel islandfrances wrightephedra sinicaspecial branchsandwich platemachine stitchplanter's punchjapanese beech
...View all with 13 letters...
Words (290)
accomplishment27apprenticeship25thermodynamics27cholinesterase19schoolteaching25narcosynthesis22unenthusiastic19unaccomplished26disenchantment22disenfranchise23mechanicalness23characterising22disinheritance20servomechanism26changelessness20architectonics23shamefacedness25monosaccharide24prosencephalon23unchangingness21methodicalness22changeableness22oceanographies22countercharges22hypermasculine26braunschweiger25handicraftsmen25psychoanalyses27encephalograms24bronchiectases23psychoanalyzed37technicalities21psychoanalyzes36mischannelling22inchoatenesses19
...View all with 14 letters...
Phrases (188)
theodor schwannbreathing spacecastle in the airchanson de gestegaston lachaisefrancis joseph istephen leacockbristol channelchinese lanterngenus chamaeleo
...View all with 14 letters...
Words (204)
pithecanthropus27unsophisticated23disenfranchised25czechoslovakianinterscholastic22enfranchisement25plainclothesman24neuropsychiatry28kinesthetically27coldheartedness22phosphocreatine27reproachfulness25accomplishments28treacherousness20echinodermatous23nonachievements25schematizations31changefulnesses24trisoctahedrons21chlorpromazines33authentications20disenchantingly25psychometrician29cyproheptadines28weltanschauungs24anticholesterol20servomechanisms27orchestrational20monosaccharides25hypervigilances29cholinesterases20apprenticeships26reorchestrating21reorchestration20chancellorships27
...View all with 15 letters...
Phrases (251)
high renaissancedialysis machineathletic contesthyoscyamus nigerpinchas zukermanchemical defensegenus anthocerosacross the nationscholarly persongenus charadrius
...View all with 15 letters...
Words (87)
enthusiasticallyuncharacteristiccharacterisationoverenthusiasticacquaintanceshipneuropsychiatricdisenfranchisingantitechnologiesmachiavellianismthermoremanencesapocryphalnessesfarfetchednessespostencephaliticarchaeoastronomyarchconservativemonotheisticallyfeatherstitchinganthropocentrismstenographicallyuntouchabilitiesstereophonicallycyanoethylationscyclohexylamineshippocastanaceaemachineabilitiespharmacogeneticskinaestheticallypharmacokineticslymphangiectasialymphangiectasisfrenchificationsanti-aestheticismacanthocephalansnanotechnologiesconservatorships
...View all with 16 letters...
Phrases (268)
manihot esculentadelphinium ajacischristian huygensochotona princepsgenus crotaphytuschemical analysisgenus chaenomelesacross the countryjohn scott haldanegenus chamaemelum
...View all with 16 letters...
Words (52)
nonmathematiciansantischizophreniaantischizophrenicleukoencephalitisdisfranchisementsthrombocytopeniascrashworthinessesarchconservativesphilosophicalnessencephalomyelitismachine-accessiblestraightjacketingpharisaicalnessesbacteriorhodopsindehumidificationstreacherousnessesdehydrochlorinaseacquaintanceshipsbiomathematiciansmechanoreceptionsneuropsychiatriesneuropsychiatristmerchantabilitiesunsympatheticallybronchopneumoniasreproachfulnessesdesynchronisationdesynchronizationanthropocentrismshexachloroethanescharacterizationsrhynchocephaliansencephalographiesaustralopithecinetracheobronchitis
...View all with 17 letters...
Phrases (274)
horizontal sectiongenus globicephalaacherontia atroposhandicapped personbureau of the censusprimary censorshiporder ornithischialine of merchandiselouisiana purchasechemical mechanism
...View all with 17 letters...
Words (29)
disenfranchisementneuropsychologicalpolymorphonuclearsmonochromaticitiesarchaeoastronomiespentachlorophenolsaustralopithecinesbacteriorhodopsinscharacteristicnessdehydrochlorinasesdehydrochlorinatesmechanochemistriesaerothermodynamicsneuropsychiatristsanticholinesteraseorder-chenopodialesphotoreactivationspseudoparenchymataunchangeablenesseschlortetracyclinesuncharitablenessesphotosyntheticallycytoarchitectonicsethnomusicologicalunenthusiasticallyneurophysiologicalirreproachablenesshypernationalistictheatricalizationsPhrases (275)
lachrymal secretionfreudian psychologygenus encephalartosantipsychotic agentnational censorshipgenus chamaecytisusrepublic of hondurassphenodon punctatumchemical operationsgenus phalacrocorax
...View all with 18 letters...
Words (30)
disenfranchisementsencephalomeningitisresorcinolphthaleinanarcho-collectivismcytopathogenicitiesimmunohistochemicalphenomenalisticallypseudohallucinationphonocardiographiesphosphatidylcholineneuropharmacologiesphosphofructokinaseneuropharmacologistcontradistinguishedcontradistinguishesmeningoencephalitismethylcholanthrenesangiocardiographieselectroretinographsencephalomyelitidesunapproachabilitiesanticholinesterasesphotoreconnaissancediethylcarbamazinesinterchangeablenesshyperconcentrationshypoadrenocorticismphacoemulsificationexhibitionisticallymischaracterizationPhrases (216)
hydrastis canadensisallium schoenoprasumgiles lytton stracheygenus cryptobranchusgenus symphoricarposcaesalpinia echinatapounds per square inchstephen michael reichirish gaelic languagechinese monetary unit
...View all with 19 letters...
Words (25)
uncharacteristicallyoverenthusiasticallyparadichlorobenzeneshyperadrenocorticismphenylthiocarbamidesinterchangeabilitiesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphofructokinasesneuropharmacologistsneurophysiologicallyneuropsychiatricallymagnetohydrodynamicsanthropocentricitiesencephalomyocarditispseudocholinesterasechlorofluoromethanespseudoparenchymatousphotoreconnaissancespseudosophisticationnephroangiosclerosisirreproachablenessesmischaracterizationsPhrases (183)
archeological remainsphotographic emulsiondivision tracheophytastephen butler leacockbalance sheet analysissphenisciform seabirdislamic calendar monthrepublic of kazakhstanernst heinrich haeckelcantharellus cibarius
...View all with 20 letters...
Words (9)
interchangeablenessesacetylcholinesteraseselectroencephalogramsadrenocorticotrophinsmeningoencephalitideselectroretinographiespseudocholinesterasespseudosophisticationstetrahydrocannabinolsPhrases (170)
acrocentric chromosomeabelmoschus esculentusfrances hodgson burnetthelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumphilosophical doctrinetelephone conversationtransmission mechanismcapital of new hampshire
...View all with 21 letters...
Words (2)
electroencephalographsencephalomyocarditisesPhrases (165)
schlumbergera truncatusleishmaniasis americanaherbert marshall mcluhanviola tricolor hortensisteacher-student relationcapital of liechtensteinrhythm and blues musicianpartnership certificatefrancois charles mauriacivan sergeevich turgenev
...View all with 22 letters...
Words (4)
laryngotracheobronchitiselectroencephalographerselectroencephalographiesdichlorodifluoromethanesPhrases (88)
argyroxiphium sandwicensetrip the light fantastic toearthur meier schlesinger jr.commonwealth of the bahamasrichard buckminster fullertechnology administrationcomprehensive examinationfranz seraph peter schuberthypersensitivity reactioncharles augustus lindbergh
...View all with 24 letters...
Phrases (86)
embryonal rhabdomyosarcomamary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalboris leonidovich pasternakrudolf christian karl dieselwar of the spanish successionmelanerpes erythrocephalus
...View all with 25 letters...
Phrases (59)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidbacon-lettuce-tomato sandwichhunting and gathering societywar of the austrian successionanton grigorevich rubinstein
...View all with 26 letters...
Phrases (39)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinelectromechanical transducerdirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunflowercryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (45)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerdistinguishing characteristiccommission on the status of womenthird council of constantinoplejohan julius christian sibeliusdepartment of homeland securitygrace ethel cecile rosalie allensergei mikhailovich eisenstein
...View all with 28 letters...
Phrases (28)
aleksandr nikolayevich scriabinchemical decomposition reactiondisorganized type schizophreniasouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitcongregational christian churchhydrangea macrophylla hortensisconstitution of the united statessecond epistle to the corinthians
...View all with 29 letters...
Phrases (22)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencejacques anatole francois thibaultrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedent
...View all with 30 letters...
Phrases (21)
united states public health servicebureau of intelligence and researchsecond epistle to the thessaloniansdigital communications technologysir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaanicius manlius severinus boethiusislamic jihad movement in palestineoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovtheory of electrolytic dissociationedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (15)
breach of trust with fraudulent intentbureau of alcohol tobacco and firearmselizabeth cleghorn stevenson gaskellsir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scanner
...View all with 33 letters...
Phrases (13)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusmassachusetts institute of technologydepartment of health and human servicesassociation of southeast asian nationsbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (8)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadetransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (9)
secretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (6)
national oceanic and atmospheric administrationcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniainternational society for krishna consciousnessPhrases (6)
nineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundunited society of believers in christ's second appearing